PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000191G0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family bZIP
Protein Properties Length: 307aa    MW: 32862 Da    PI: 6.7431
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000191G0100genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.81.5e-10169227563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      k+++r   NR +A rs +RK  +i+eLe+kv++L ae ++L  +l  l+ +   l++e+
  PH01000191G0100 169 KKAKRIWANRQSAARSKERKMRYIAELERKVQTLHAEATTLSTQLALLQRNTTGLTTEN 227
                      899******************************************99998887777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-16165229IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.484167230IPR004827Basic-leucine zipper domain
PfamPF001704.1E-9169226IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-10169221No hitNo description
Gene3DG3DSA:1.20.5.1706.2E-10169223No hitNo description
CDDcd147038.33E-22170219No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MDKSPIPEGG GGGDAGGGGN GNDLPPPPPP PPECDISRMP DFPPRNPGHR RAHSEIIGLP  60
DDLDIGVPGA GDAPSLSEEN EEELFSMFLD VEKLNSPCGA SGAESSCVMA GAGAGPRPRH  120
QHSHSMDVSS YDKTEQLLGT PAMKGMSPAE ATKAMSTAKL AELALVDPKK AKRIWANRQS  180
AARSKERKMR YIAELERKVQ TLHAEATTLS TQLALLQRNT TGLTTENSEL KMRLQNAEQQ  240
VHLQDALNGT LKSELQRLKM ATGQMGNGGG MNFGGLPHSF GRNQQMFHPQ NQAMQPLLTT  300
HQMQHL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000191G0100
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020181798.11e-137transcription factor RF2a-like
RefseqXP_020181799.11e-137transcription factor RF2a-like
SwissprotQ69IL41e-119RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A3B6RIM41e-142A0A3B6RIM4_WHEAT; Uncharacterized protein
TrEMBLA0A446XE691e-142A0A446XE69_TRITD; Uncharacterized protein
STRINGSi015587m1e-135(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.14e-78bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]