PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000176G0670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 485aa    MW: 52718.3 Da    PI: 9.6702
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000176G0670genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.38.3e-42181257278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      CqvegC++dls++k+yhr+hkvCe+hskap+v+v+gle+rfCqqCsrfh l efD++krsCrrrL++hn+rrrk+q+
  PH01000176G0670 181 CQVEGCKVDLSSVKDYHRKHKVCEAHSKAPKVVVAGLERRFCQQCSRFHGLAEFDQKKRSCRRRLSDHNARRRKPQP 257
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.9E-34173242IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.684178255IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-39180260IPR004333Transcription factor, SBP-box
PfamPF031107.9E-32181254IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MGSFGMNWNQ KNSMLWDWEN LAPLGPNSME NPKNVSHHEP RVVGVGVARH GSTNSSGGTF  60
TSSSELGHGS SKSSMSASID SPSKVGNGLE FKFAAVKGHD KNMDKGGEAG RVEDSGTSPS  120
SMMAVSHGEP LIGLKLGKRT YFENVCGGQI VKSSASSGVT SPCTVVKKAK VSQQSTQSSY  180
CQVEGCKVDL SSVKDYHRKH KVCEAHSKAP KVVVAGLERR FCQQCSRFHG LAEFDQKKRS  240
CRRRLSDHNA RRRKPQPETI SFSSSRLSTM FYDARQQTNH LFSQSPFGQV RSNAISSWDS  300
LGGFKFTETK LPWMKPTRMV GLDELHFSNP QMPSNVVAHS VHHHDFDGLM PFKGTNMKVL  360
NQVLVKHVPV GVETRLQRPI LSCVEVSTIV ANSNGAPDLR RALSLLSNDS WGSTDIQSSS  420
QVHSSSVMPP LATITTSNPV MHALDPSPGG FWQDDPPPLD QTVQVQAFTH LSNGGSSGYG  480
QMQY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-281812541184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1236253KKRSCRRRLSDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000176G0670
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0967320.0FP096732.1 Phyllostachys edulis cDNA clone: bphylf045e11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656454.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694397.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694398.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694399.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694400.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694401.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694402.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694403.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694404.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694405.10.0PREDICTED: squamosa promoter-binding-like protein 12
SwissprotA2YGR50.0SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLA0A3Q8B7U90.0A0A3Q8B7U9_9POAL; Squamosa-promoter binding protein-like protein
STRINGOB06G34330.10.0(Oryza brachyantha)
STRINGOPUNC06G24320.20.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-55squamosa promoter binding protein-like 2