PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000142G0610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GeBP
Protein Properties Length: 277aa    MW: 29813.4 Da    PI: 6.3651
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000142G0610genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573561.1e-177861797
           DUF573 17 qGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                     qGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+Kf+  ++++++g +p+  ++hd+++++l++++W+
  PH01000142G0610  7 QGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKFRSVSARVARGLDPARLAPHDRDVLHLCSRLWD 86
                     777777.445766677****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.0E-15886IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MAGKLEQGLL GCGAQGLVFP RDLNVFYDRF SESMPQPYTR SQLSEKLRRL KNKFRSVSAR  60
VARGLDPARL APHDRDVLHL CSRLWDPTNA ATSPFAANAG TSGNKRRRAN PQSGAAAPLA  120
LLAPSGDSNS HDYNGISSGT PGAFPDGNGE DMMYLEQEST HLYDIEGAAL VAADGILDGI  180
TKGQPETVAA LPNIGDTGVG NENGNCKVVV PCSNEHRMAN AVLDVFEECL REAKANGSAE  240
DSELAKRWRA QRIDELDVLS RRLRLLIEDA QRLGTK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000142G0610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0944720.0FP094472.1 Phyllostachys edulis cDNA clone: bphylf057n04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231034.11e-143probable transcription factor At5g28040
TrEMBLI1GP541e-142I1GP54_BRADI; Uncharacterized protein
STRINGBRADI1G11200.11e-143(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.19e-10DNA-binding storekeeper protein-related transcriptional regulator