PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000129G1060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HD-ZIP
Protein Properties Length: 306aa    MW: 33389.6 Da    PI: 4.4846
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000129G1060genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.4e-1963115456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      ++++  eq+++Le+ Fe +++++ ++++++A+ lgL+ rqV vWFqNrRa++k
  PH01000129G1060  63 KRRLALEQVRALERSFETDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWK 115
                      4467789*********************************************9 PP

2HD-ZIP_I/II128.42.9e-4161153193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrl+ eqv++LE+sFe+++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++e
  PH01000129G1060  61 EKKRRLALEQVRALERSFETDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFSALRARHDALRADCDALRRDKDALAAEIRE 153
                      69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-1954119IPR009057Homeodomain-like
SMARTSM003892.6E-1960121IPR001356Homeobox domain
PROSITE profilePS5007116.58461117IPR001356Homeobox domain
CDDcd000863.39E-1862118No hitNo description
PfamPF000462.6E-1663115IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.5E-2069116IPR009057Homeodomain-like
PRINTSPR000312.7E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000312.7E-597113IPR000047Helix-turn-helix motif
PfamPF021835.2E-16117158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MKRPTSSQES SESGEKLALA EKDSLLAPYM EQYEPELEVD DDDDELAGGR GVLSSSCGLG  60
EKKRRLALEQ VRALERSFET DNKLDPDRKA RIARDLGLQP RQVAVWFQNR RARWKTKQLE  120
RDFSALRARH DALRADCDAL RRDKDALAAE IRELTEKLSK PETEVKVEAG NDAAEERQAT  180
LGASAAAIYK DGSSDSDSSV VFNDEASPYS SAVLEQPGFM GFGASFLDSS AATMGCSSLP  240
MLETKFHGTY SYNSYKSSGY GFTEEWLAGS DAIGNDGAGF FSEEHASNLN FGWCGSGTEG  300
FDLHG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109117RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000129G1060
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190062.11e-143homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-118HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A453IYQ51e-141A0A453IYQ5_AEGTS; Uncharacterized protein
STRINGTraes_4BL_ECD20BE67.11e-142(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.23e-31homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]