PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000117G1390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 412aa    MW: 43398.6 Da    PI: 7.8574
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000117G1390genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.72.5e-41111187278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      C v+gC+adls++++yhrrhkvCe+hsk+pvv+v+g+e rfCqqCsrfh l efDe+krsCr+rL++hn+rrrk+q+
  PH01000117G1390 111 CAVDGCKADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHLLAEFDEAKRSCRKRLDGHNRRRRKPQP 187
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.8E-36103172IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.342108185IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.01E-38109190IPR004333Transcription factor, SBP-box
PfamPF031103.2E-31111184IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDWDLKMPPA WDLAELEHDA GSAKAAPAAA AVGGPASSGI TAAGRPECSV DLKLGGLGEF  60
GAPAAAADSR KEPVPAKGPA AASPSAAKRP RPAGGGGGSG SSGGAGQCPS CAVDGCKADL  120
SKCRDYHRRH KVCEAHSKTP VVVVAGREMR FCQQCSRFHL LAEFDEAKRS CRKRLDGHNR  180
RRRKPQPETM NSASFITSQQ GARFSSFPSP RPEPNWPGII KTESPYYTHQ IPLGISNRQH  240
FVGSTSTYTK ESRRFPFLQE GEINFATGVA LEASVCQPLL ETVAPPESSS KMFSDGLTPV  300
LDSDCALSLL SAPANSSGID VSRMVQPTEH IPMAQPLMSS LQFGSSSWFA RSQASIGAVS  360
TARFSCPAVE SEQLNTVLSS NDNGMNYNGI FHVGGEGSSD GTSPSLPFSW Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-28100184184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18791KRPRP
2167184KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000117G1390
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0949130.0FP094913.1 Phyllostachys edulis cDNA clone: bphyem212i14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194874.10.0squamosa promoter-binding-like protein 16
SwissprotQ6YZE81e-158SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBLA0A3Q8AHR90.0A0A3Q8AHR9_9POAL; Squamosa-promoter binding protein-like protein
STRINGBRADI3G41250.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-43SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY
    High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice.
    Theor. Appl. Genet., 2011. 122(8): p. 1489-96
    [PMID:21327937]
  3. Wang S, et al.
    Control of grain size, shape and quality by OsSPL16 in rice.
    Nat. Genet., 2012. 44(8): p. 950-4
    [PMID:22729225]
  4. Wang S, et al.
    The OsSPL16-GW7 regulatory module determines grain shape and simultaneously improves rice yield and grain quality.
    Nat. Genet., 2015. 47(8): p. 949-54
    [PMID:26147620]
  5. Wang Y, et al.
    A comprehensive meta-analysis of plant morphology, yield, stay-green, and virus disease resistance QTL in maize (Zea mays L.).
    Planta, 2016. 243(2): p. 459-71
    [PMID:26474992]
  6. Lee CM, et al.
    Influence of Multi-Gene Allele Combinations on Grain Size of Rice and Development of a Regression Equation Model to Predict Grain Parameters.
    Rice (N Y), 2015. 8(1): p. 33
    [PMID:26519289]
  7. Bessho-Uehara K, et al.
    Loss of function at RAE2, a previously unidentified EPFL, is required for awnlessness in cultivated Asian rice.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(32): p. 8969-74
    [PMID:27466405]