PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000095G1560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 329aa    MW: 35560.8 Da    PI: 8.3688
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000095G1560genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.42.3e-3954130177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +CqvegC +++ +akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q
  PH01000095G1560  54 RCQVEGCGVEMGSAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQ 130
                      6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-3248116IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.74452129IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-3853134IPR004333Transcription factor, SBP-box
PfamPF031102.1E-3055128IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MEWTAPKPTS LSSPPLLWDW GDAAVPGSSG EAAGRRGKEK RAKGEEGGGG GEVRCQVEGC  60
GVEMGSAKEY HRKHRVCEAH TKCPRVVVAG QERRFCQQCS RFHALSEFDQ KKRSCRRRLS  120
DHNARRRKPQ LDAFSFGSAR LPSSLLFDDR QHISFVWNKA PVSHVRPSAC SPWDSPSDFK  180
LPHVKEIREI SAKIGTTYGQ VHLDKSHLSN ALPTLSHDID ELLPMKGPDA SLTASTLDGA  240
PDLQRALSLL SASSCGLPDP VQQASCLIQF TGASQNSGDL PLSHGGNSAS ASCAEGQPRA  300
PPSQLIRFTM DASSNGYEST FFGVNQIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-2648128484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110127KKRSCRRRLSDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000095G1560
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1010320.0FP101032.1 Phyllostachys edulis cDNA clone: bphyem201p14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.10.0squamosa promoter-binding-like protein 4
SwissprotQ653Z51e-101SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLA0A3Q8AYS50.0A0A3Q8AYS5_9POAL; Squamosa-promoter binding protein-like protein
STRINGTraes_6AS_32A35158A.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.49e-40squamosa promoter binding protein-like 10