PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000071G0980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NAC
Protein Properties Length: 271aa    MW: 30932.9 Da    PI: 11.3884
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000071G0980genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.99.9e-50521772128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++PwdLp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + ++
  PH01000071G0980  52 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWDLPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAE 144
                      79***************************.89***************888889***************************************** PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkktLvfy+g+apkg++ +W+m+eyrl
  PH01000071G0980 145 NHRPIGLKKTLVFYSGKAPKGVRRSWIMNEYRL 177
                      *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.74151198IPR003441NAC domain
SuperFamilySSF1019417.19E-5651198IPR003441NAC domain
PfamPF023659.9E-2553177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MRRRNGEDEA GMSRCENGHG AAVAAAAGGG VGAGGNKAGD GGGDAHEDDL VMPGFRFHPT  60
EEELIEFYLR RKVEGKRFNV ELITFLDLYR YDPWDLPAMA AIGEKEWFFY VPRDRKYRNG  120
DRPNRVTASG YWKATGADRM IRAENHRPIG LKKTLVFYSG KAPKGVRRSW IMNEYRLPTA  180
DTDRYHKTEI SLCRVYKRSG IDDGHGHLSS ARLTPSAAPR HRRTTNKRRR LPRPRRPRLR  240
PSSTNFSRAS ARRRPPSQIT PRDTRRRRNG S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-545319919166NO APICAL MERISTEM PROTEIN
1ut4_B1e-545319919166NO APICAL MERISTEM PROTEIN
1ut7_A1e-545319919166NO APICAL MERISTEM PROTEIN
1ut7_B1e-545319919166NO APICAL MERISTEM PROTEIN
3swm_A1e-545319922169NAC domain-containing protein 19
3swm_B1e-545319922169NAC domain-containing protein 19
3swm_C1e-545319922169NAC domain-containing protein 19
3swm_D1e-545319922169NAC domain-containing protein 19
3swp_A1e-545319922169NAC domain-containing protein 19
3swp_B1e-545319922169NAC domain-containing protein 19
3swp_C1e-545319922169NAC domain-containing protein 19
3swp_D1e-545319922169NAC domain-containing protein 19
4dul_A1e-545319919166NAC domain-containing protein 19
4dul_B1e-545319919166NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1226230KRRRL
2251267RRRPPSQITPRDTRRRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000071G0980
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0941370.0FP094137.1 Phyllostachys edulis cDNA clone: bphylf036g16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695832.11e-118PREDICTED: NAC transcription factor ONAC010
SwissprotQ9ZVP81e-99NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A0D9V8R61e-116A0A0D9V8R6_9ORYZ; Uncharacterized protein
STRINGTraes_3B_715E4224C.21e-121(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-101NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]