PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000053G1380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family ZF-HD
Protein Properties Length: 97aa    MW: 10243.3 Da    PI: 8.0557
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000053G1380genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.69.9e-312884360
      ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                      v+YkeC++NhAas+Gg+avDGC+Efm+s g+egtaaal CaACgCHR+FH+reve e
  PH01000053G1380 28 IVHYKECQRNHAASIGGYAVDGCREFMAS-GAEGTAAALLCAACGCHRSFHKREVEAE 84
                     589*************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-112784IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.1E-302981IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.8E-263081IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.8543180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MGPQQDRSAS KAYANGTAAR AGRKENKIVH YKECQRNHAA SIGGYAVDGC REFMASGAEG  60
TAAALLCAAC GCHRSFHKRE VEAECDCSSD TSSDRR*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000053G1380
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126204e-52CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
GenBankCT8337334e-52CT833733.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA035B08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663173.14e-48PREDICTED: mini zinc finger protein 1-like
SwissprotB8BIU88e-42MIF1_ORYSI; Mini zinc finger protein 1
SwissprotQ2RB288e-42MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBLK3ZLE61e-46K3ZLE6_SETIT; Uncharacterized protein
STRINGSi027403m2e-47(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.16e-17mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]