PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000040G1230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 950aa    MW: 103584 Da    PI: 5.9523
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000040G1230genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.33.3e-41136213178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC adl+ ak+yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  PH01000040G1230 136 ACQVEGCGADLTAAKDYHRRHKVCEMHAKATTAVVGNVVQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNRRRRKARP 213
                      5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.8E-34130198IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.624134211IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.29E-38135215IPR004333Transcription factor, SBP-box
PfamPF031102.9E-30137210IPR004333Transcription factor, SBP-box
SuperFamilySSF484035.33E-7708844IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502978.667741804IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.2E-7742843IPR020683Ankyrin repeat-containing domain
CDDcd002044.63E-8746842No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 950 aa     Download sequence    Send to blast
MEAARVGAQS RQKRVFGWDL NDWSWDSERF VATPVLAAAG NGLALNSSPS SSEEAEAQVA  60
RSGNVRGDSD KRKRVVVIDD DDVEDEDPMD SGGGALSLRI GGDGVSGGAV EGGGVNEEER  120
NGKKIRVQGD SSSGPACQVE GCGADLTAAK DYHRRHKVCE MHAKATTAVV GNVVQRFCQQ  180
CSRFHLLQEF DEGKRSCRRR LAGHNRRRRK ARPEIAVGGT ASIEDKVGSY LLLSLLGICA  240
NLNSDNAEHL KGHELLSNLW RNLGTVAKSL DPKELCKLLE ACQSMQNGSN AGTSETANAL  300
FNTAAAEAAG PSNSKVPFVN GGRCGQASSS VAPVQSKATM VATPEPPACK FKDFDLNNTC  360
IDMEGFEDGY KGSPAPAFKA TDSPNCPSWM QQDSTQSPPQ TSGNSDSTSA QSLSSSNGDA  420
QYRTDKIVFK LFEKVPSDLP PVLRSQILGW LSSSPTDIES YIRPGCIILT VYVRLVESAW  480
RELSDNMSSH LVKLLSSSSD NFWASGLVFV MVRHQIAFMH NGQVTLDRPL APNSHRYCKI  540
LCVQPVAVPY SATVNFKVEG FNLVGASSRL ICSFEGRCIF QEDTAIVADD VEHEDTECLN  600
FCCPLPGSRG RGFIEAQLVE DGGFSNGFFP FIIAEQDVCT EVCELESIFK SSSYEQADDD  660
NSRNQALEFL NELGWLLHRA NTISKHDKVE LPQAAFNLWR FRNLGIFAME REWCAVTKML  720
LDFLFIGLVD VGSQSPEEVV LSENLLHTAV QRKSVRMVRF LLRYKPNKSL NTYLFRPDAW  780
GPSTITPLHI AAATTDAEDV LDALTDDPGL VGISVWRNAR DETGFTPEDY ARQRGNDAYM  840
NMVQKKIDKH LGKGHVVLGV PSNMCPVITD GVKPGGMPLA PPVPSCNICS RQALMYPNSA  900
ARTFLYRPAM LTVMGVAVIC VCVGILLHTF PKVYAAPTFR WELLERGAM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30131210584squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000040G1230
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631511.10.0squamosa promoter-binding-like protein 6 isoform X1
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLA0A3Q8ANT30.0A0A3Q8ANT3_9POAL; Squamosa-promoter binding protein-like protein
STRINGOGLUM03G39810.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]