PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000038G2120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HD-ZIP
Protein Properties Length: 311aa    MW: 34017.3 Da    PI: 4.7093
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000038G2120genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.2e-1968120456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      ++++  eq+++Le+ Fe +++++ ++++++A+ lgL+ rqV vWFqNrRa++k
  PH01000038G2120  68 KRRLAVEQVRALERSFETDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWK 120
                      457889**********************************************9 PP

2HD-ZIP_I/II1291.9e-4166158193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrl+ eqv++LE+sFe+++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e+++
  PH01000038G2120  66 EKKRRLAVEQVRALERSFETDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDALRADCDALRRDKDALAAEIRK 158
                      69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-1957124IPR009057Homeodomain-like
SMARTSM003891.0E-1965126IPR001356Homeobox domain
PROSITE profilePS5007116.64966122IPR001356Homeobox domain
CDDcd000862.17E-1867123No hitNo description
PfamPF000461.4E-1668120IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-2074121IPR009057Homeodomain-like
PRINTSPR000312.8E-593102IPR000047Helix-turn-helix motif
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
PRINTSPR000312.8E-5102118IPR000047Helix-turn-helix motif
PfamPF021837.5E-16122163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MKRQMKRPTS SQESSEPGQK PAFDDKNSLL APYMEHDEAE LEELDDDDDE HAGGRGAPSS  60
SCGLGEKKRR LAVEQVRALE RSFETDNKLD PDRKARIARD LGLQPRQVAV WFQNRRARWK  120
TKQLERDFAA LRARHDALRA DCDALRRDKD ALAAEIRKLT EKLSKPETAV KAEAGNDAAE  180
ERQATVGTSA AAIYKDGFSD SDSSVVFNDE ASPYSVAVLE QPGFIGFGAS FLDSSAATTV  240
CSSLPMLETK WHGTYSYDSY KNGGYGFTEE WLAGSDAIGN DGAGFFSEEH ASNLNFSWCG  300
SGTDGVDLHG *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114122RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000038G2120
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190062.11e-144homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-116HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A453IYQ51e-143A0A453IYQ5_AEGTS; Uncharacterized protein
STRINGTraes_4BL_ECD20BE67.11e-143(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.27e-30homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]