PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000022G1910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YB
Protein Properties Length: 189aa    MW: 19842.1 Da    PI: 5.3451
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000022G1910genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1841.2e-5733129197
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdk+qrekrktingddllwa+atlGfedy+eplkvyl+kyre+e
  PH01000022G1910  33 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKSQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREME 126
                      69******************************************************************************************** PP

            NF-YB  95 gek 97 
                      g++
  PH01000022G1910 127 GDS 129
                      *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.6E-5431138IPR009072Histone-fold
SuperFamilySSF471132.95E-3936133IPR009072Histone-fold
PfamPF008083.8E-2739103IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.0E-216785No hitNo description
PRINTSPR006151.0E-2186104No hitNo description
PRINTSPR006151.0E-21105123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MADAPASPGG GGESHDSGSP RGGGGGGGGG RGVREQDRFL PIANISRIMK KAIPANGKIA  60
KDAKETVQEC VSEFISFITS EASDKSQREK RKTINGDDLL WAMATLGFED YIEPLKVYLQ  120
KYREMEGDSK LSAKAGDGSV KKDAVGPHGG ASSSSAQGMG QQGSYNQEMG LCNLSTIMGT  180
SQTEDMYLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-4832124193NF-YB
4awl_B1e-4832124294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-4832124294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12030RGGGGGGGGGR
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000022G1910
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0934100.0FP093410.1 Phyllostachys edulis cDNA clone: bphyst026n20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025806249.11e-90nuclear transcription factor Y subunit B
RefseqXP_025806250.11e-90nuclear transcription factor Y subunit B
SwissprotP252097e-88NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLA0A2T7ECR31e-89A0A2T7ECR3_9POAL; Uncharacterized protein
STRINGPavir.J02009.1.p3e-89(Panicum virgatum)
STRINGSi023400m4e-89(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.31e-70nuclear factor Y, subunit B8
Publications ? help Back to Top
  1. Li XY, et al.
    Evolutionary variation of the CCAAT-binding transcription factor NF-Y.
    Nucleic Acids Res., 1992. 20(5): p. 1087-91
    [PMID:1549471]