PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000018G0890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family VOZ
Protein Properties Length: 540aa    MW: 60181.5 Da    PI: 5.2551
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000018G0890genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ424.71.5e-1302404571217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                      p+p+afl pkcalwdc+rpaqgse++qdycs++ha+la++e g+pgt+pv+rp+gidlkd++lfaalsak+qgk+vgip+cegaatakspwna+
  PH01000018G0890 240 PAPAAFLMPKCALWDCPRPAQGSERWQDYCSMYHAELAVKEeGPPGTMPVIRPRGIDLKDAPLFAALSAKIQGKHVGIPVCEGAATAKSPWNAP 333
                      89*************************************9879*************************************************** PP

              VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                      elfdl ++ege+irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlyeyein++da+alyrle+
  PH01000018G0890 334 ELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYEYEINDSDAFALYRLEF 427
                      ********************************************************************************************** PP

              VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                      k++d+kk ak+k+++++l+++qk+++rl a
  PH01000018G0890 428 KSSDAKKGAKSKLACNPLNEIQKQMVRLGA 457
                      ***************************975 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MGMGSPRHQQ FRARAKTRVD DLQDMFSGLQ SARKEARSTD AAVLEAQLHQ MLREWRAELS  60
GNNWVPSDPP SETLRLLQLA AAEEEDDATS KFVEQQAPPS ANQAHGHAQG SQDMKPEPCE  120
EAVDTVAAVV VVQQPLGQGV LANGGGVLAP AAAAFHDQMY YVNQELTVED FLYDDGYKIN  180
LPASNPDVLN NLEGIGQLEY PQFNLPQELP PHVYLGMSNC GQSAGDVFLH MSDLLTTMSP  240
APAAFLMPKC ALWDCPRPAQ GSERWQDYCS MYHAELAVKE EGPPGTMPVI RPRGIDLKDA  300
PLFAALSAKI QGKHVGIPVC EGAATAKSPW NAPELFDLYI FEGESIREWL FFDKPRRAFE  360
SGNRKQRSLP DYNGRGWHES RKQVMKDFGG LKRSYYMDPQ PSSSYEWHLY EYEINDSDAF  420
ALYRLEFKSS DAKKGAKSKL ACNPLNEIQK QMVRLGADSP VENKRMARSR TKANPKDINV  480
NIYSVQNTTV QANVPNAYQA VSQMDHMTFL NGNVVYGPHL PYGYSTERND FYWNSNDGM*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000018G0890
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417650.0AK241765.1 Oryza sativa Japonica Group cDNA, clone: J065205E23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688108.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-147VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0E0JNT00.0A0A0E0JNT0_ORYPU; Uncharacterized protein
STRINGOBART01G31110.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-136vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]