PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000004G1130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Dof
Protein Properties Length: 325aa    MW: 34749.6 Da    PI: 4.7682
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000004G1130genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.56.1e-383489661
           zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                      +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  PH01000004G1130 34 PNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 89
                     68***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-371688IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8543488IPR003851Zinc finger, Dof-type
PfamPF027018.1E-323488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MLSSHHHEAM LPYAPQPPSL LVDRRYKQGA EVAPNCPRCD SPNTKFCYYN NYSLSQPRYF  60
CKGCRRYWTK GGSLRNVPVG GGCRKNRRGK SSVRSAAESI ASGRDATFGH RFPGPVRPDL  120
VLEGMVSHPT NPDQAMCDVP AATDGSTIDL AMLYAKFLNN QPADAGVGAV TPEPAGHVDE  180
TFDKFSASSD LSPGVLAPAQ FDPTQDGFGE WSGTVSSTHP TSTTSTTAAT TVLCTDVSVQ  240
AALSELNFAM DQSCFDSLGL PTDGTGNLSS WCSVVPSLST WEEAKYDSLD SFPDDAMSLH  300
EGMISAADHD WSVDCQGLEA LYIP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032700.0AP003270.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0505D12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970693.10.0PREDICTED: uncharacterized protein LOC101752604
TrEMBLK3XK070.0K3XK07_SETIT; Uncharacterized protein
STRINGSi002230m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-37Dof family protein