PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000002G1660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 426aa    MW: 46155.9 Da    PI: 8.2429
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000002G1660genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP73.92.8e-2361113252
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS..EEET CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr..fhel 52 
                      C vegC+adls+++eyhrrhkvCe+hsk+p v+v+g++qrfCqqCs   +he+
  PH01000002G1660  61 CSVEGCTADLSKCREYHRRHKVCEAHSKTPFVTVAGQQQRFCQQCSSdlWHEV 113
                      *********************************************95335655 PP

2SBP48.22.9e-151671984778
                      SSEEETTT--SS--S-STTTT-------S--- CS
              SBP  47 srfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       rfh l efDe krsCr+rL++hn+rrrk+q+
  PH01000002G1660 167 CRFHLLGEFDEVKRSCRKRLDGHNRRRRKPQP 198
                      59***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-2852104IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.91458196IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.02E-2259107IPR004333Transcription factor, SBP-box
PfamPF031106.5E-1861113IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-12145201IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.9E-28166183IPR004333Transcription factor, SBP-box
PfamPF031103.2E-7168195IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MPSWDLGTVV GPSGVGGGGA LDLKLGAPTS WKAAAVAPVP PSPGTAKRPR AGQGQQAVPA  60
CSVEGCTADL SKCREYHRRH KVCEAHSKTP FVTVAGQQQR FCQQCSSDLW HEVEAMWKFD  120
HIGHQQGILQ LLVDLHQLSR NGEIRFRLCI HGDLTWEILM IGRTLLCRFH LLGEFDEVKR  180
SCRKRLDGHN RRRRKPQPDP LNPGGLFANH HGATRFASYP QIFSTTSMAE PKWPASAVKT  240
ESTAFHEPYY PALHLNGAAS LFHGKERKHF PFLTDHGDAA ATVFSCQPFT ITPSSESSSN  300
SSRHSNGKMF AHDGGLDNCA LSLLSDSPTP AQIMIPAAQP LGGAGIQYGS VARLPNDSDV  360
SLTRLSYVRV EDKNTSILAT STSHTATATA TSAAATQLQY HGYYHVNADQ GNSDDAIQAL  420
PFSSW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A6e-1561106651squamosa promoter-binding protein-like 12
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178195KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000002G1660
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020178580.11e-134squamosa promoter-binding-like protein 2
SwissprotQ0JGI11e-119SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLA0A3S6H6620.0A0A3S6H662_BAMOL; Squamosa-promoter binding protein-like protein
STRINGPavir.J02262.1.p1e-130(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.17e-20SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]