PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000000G1660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRAS
Protein Properties Length: 611aa    MW: 64197.6 Da    PI: 8.1109
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000000G1660genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.38e-912436092373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A a+++g++e+a+  L+ l++ a+p+gd  qRl+a+++ AL++r+a       ++ p+++ ++   +e+ a  +l++++sP+++++ 
  PH01000000G1660 243 RQLLSEAAVAIADGNHEKATFHLTALKHAANPRGDVEQRLVAMMVAALSSRIAP-----TASAPSQHLADLCGAEQRARSQLLHNISPCFRLAL 331
                      689**************************************************9.....4445555555555888888889************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +aN aI+ av  ++++H +Dfd+s   Q +aL+q La+R+ +   l++T+v++p+s      + +l ++ge+L+k+Ae+ g++ +f+v v+ r
  PH01000000G1660 332 HAANIAIVYAVTDHRAIHLVDFDVSV-SQHAALIQHLADRRVPGTFLKVTAVADPSSPfthsLTATLPAVGEQLKKLAERAGIEYRFKV-VSCR 423
                      ************************97.6**************************99888887788999********************9.7899 PP

             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       +++e ++L ++pgEal+Vnl+++l +++desvs +++rde+L+ v+ l P+vv + eqe++ n++++++rf++a+ +y a+++sl+a+ +res
  PH01000000G1660 424 AAEIEASKLGCEPGEALVVNLAFALSHVPDESVSPANPRDELLRRVRALGPQVVALLEQELNSNTAPLATRFSDACAHYGAILESLDATRGRES 517
                      ********************************************************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       er+  E++ l++++ n+v  eg +r er+e ++kWr+r+++aGF+pvpl   +a+q+ + l   +  g+ ++ e+g l lgW++r ++++SaW
  PH01000000G1660 518 AERARAEAA-LAKKAANAVGREGPDRLERCEVFGKWRARFGMAGFRPVPLVPGIADQVMARLGPAP-PGFAIKPENGVLRLGWMGRVVTVASAW 609
                      ********9.9******************************************************9.9************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.735216591IPR005202Transcription factor GRAS
PfamPF035142.8E-88243609IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYVYGVES AMQQRSDAAT SGGVLKRSLG EIERWQHQQQ RQVAVQQALY  60
LRAVRQRTAA TSAAVSPLTS ADIAAVLGGG PSQPLVLSGS SLGGALSSST LSSLTTAQRQ  120
VPSFVLPSPQ AQALGVARAA APPATASELS ILQELEKQLL GDDDEAEAAM SGTGSAATNS  180
EWEETIQQLN SITAAPSRPL PTVAAPNNNT TTAGMTRSPS NSSTSTASSS ASCSPPTSAN  240
TSRQLLSEAA VAIADGNHEK ATFHLTALKH AANPRGDVEQ RLVAMMVAAL SSRIAPTASA  300
PSQHLADLCG AEQRARSQLL HNISPCFRLA LHAANIAIVY AVTDHRAIHL VDFDVSVSQH  360
AALIQHLADR RVPGTFLKVT AVADPSSPFT HSLTATLPAV GEQLKKLAER AGIEYRFKVV  420
SCRAAEIEAS KLGCEPGEAL VVNLAFALSH VPDESVSPAN PRDELLRRVR ALGPQVVALL  480
EQELNSNTAP LATRFSDACA HYGAILESLD ATRGRESAER ARAEAALAKK AANAVGREGP  540
DRLERCEVFG KWRARFGMAG FRPVPLVPGI ADQVMARLGP APPGFAIKPE NGVLRLGWMG  600
RVVTVASAWH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3226461025375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7291720.0KP729172.1 Stipa purpurea microsatellite ZH29 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLI1J0W50.0I1J0W5_BRADI; Uncharacterized protein
STRINGBRADI5G19190.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-87SCARECROW-like 8