PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.J01913.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 352aa    MW: 38840.4 Da    PI: 6.6349
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.J01913.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.83.2e-51231551129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF+P+dee++++yL++kv+++++++  +i evd++ +ePw+Lp k++ +ekewyfF ++d+ky++g r nratk gyWkatgkdke++ +
  Pahal.J01913.1  23 LPPGFRFNPSDEEIITFYLTPKVQQRSFTC-AAIGEVDLNGAEPWELPGKANMGEKEWYFFYQKDRKYRKGIRMNRATKGGYWKATGKDKEIYGA 116
                     79**************************99.88***************99999****************************************98 PP

             NAM  96 kgel.....vglkktLvfykgrapkgektdWvmheyrle 129
                     ++ +     +g+kktLvfy+grap+g+kt+W+mheyrle
  Pahal.J01913.1 117 TTGVvlpvlIGMKKTLVFYTGRAPRGKKTSWIMHEYRLE 155
                     544467778****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-5916191IPR003441NAC domain
PROSITE profilePS5100555.67823191IPR003441NAC domain
PfamPF023651.4E-2724154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGDQHQQPQP QPQRMHGGGG LDLPPGFRFN PSDEEIITFY LTPKVQQRSF TCAAIGEVDL  60
NGAEPWELPG KANMGEKEWY FFYQKDRKYR KGIRMNRATK GGYWKATGKD KEIYGATTGV  120
VLPVLIGMKK TLVFYTGRAP RGKKTSWIMH EYRLEGDDRL PYPAANSIPT VTMKSSSAFK  180
DKWVVCRVFH KITGIKKEPA SPPYNNAMDD IRIDQSSVHM PLPLEFPVLP DFTMDPAGIN  240
YSTTDVSSSS LPHVIPPGIA GMGVTMLQMN NASLGNSMAV APQMPFYHQT NIGTVDASGF  300
MAALQGVPSL MVSQNDAGMS IDQTNDAEIP SMVPIVPEST TTMDMDSLWE Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-4511974171NO APICAL MERISTEM PROTEIN
1ut4_B2e-4511974171NO APICAL MERISTEM PROTEIN
1ut7_A2e-4511974171NO APICAL MERISTEM PROTEIN
1ut7_B2e-4511974171NO APICAL MERISTEM PROTEIN
3swm_A2e-4511977174NAC domain-containing protein 19
3swm_B2e-4511977174NAC domain-containing protein 19
3swm_C2e-4511977174NAC domain-containing protein 19
3swm_D2e-4511977174NAC domain-containing protein 19
3swp_A2e-4511977174NAC domain-containing protein 19
3swp_B2e-4511977174NAC domain-containing protein 19
3swp_C2e-4511977174NAC domain-containing protein 19
3swp_D2e-4511977174NAC domain-containing protein 19
4dul_A2e-4511974171NAC domain-containing protein 19
4dul_B2e-4511974171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025815672.10.0NAC domain-containing protein 87-like
SwissprotQ9FLJ23e-68NC100_ARATH; NAC domain-containing protein 100
SwissprotQ9FLR32e-68NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A270R5D70.0A0A270R5D7_9POAL; Uncharacterized protein
STRINGPavir.Eb00898.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.27e-71NAC domain containing protein 80
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]