PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.J01339.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GeBP
Protein Properties Length: 352aa    MW: 37259.4 Da    PI: 7.6444
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.J01339.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57339.12.1e-121071594597
          DUF573  45 isfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     +   +++ ql+eK+rrLK+K++  +++++ g +p+  ++hd+++++l++++W+
  Pahal.J01339.1 107 MPQPYTRAQLSEKLRRLKNKYRSVSARVAGGLDPARLAPHDRDVLHLCSRLWD 159
                     6677899*********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-1481159IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MASGQQALPV PAPVPPNPNP TAPADPTPPA GARKLPIKRR SPRPSSSPPS SSSPASSDPL  60
RAPAAGGGGA GSDQQQPPFK FQRIWSESDE LRFLQGLLGC GAQGLSMPQP YTRAQLSEKL  120
RRLKNKYRSV SARVAGGLDP ARLAPHDRDV LHLCSRLWDP ANAATSPFTS GGGASGNKRR  180
RANPRGTQLL APDASGDSNS HDYNGVSSSA PGLFPDVSNG EDVFYLEQES RHLGDHEGAT  240
LDSKFGVIVQ EQPEDVVALP NGNNGIGNEI GDHKVVVPCS NEHRMANAVL DVFEECLREA  300
KASGIINNGN VGGSAEESEL AKRWRVQRMD ELHVLSRRLR LLVEDAAAAG H*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143574.11e-177uncharacterized protein LOC100276272
TrEMBLB6T7U51e-177B6T7U5_MAIZE; Putative uncharacterized protein
STRINGSi036257m1e-176(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.23e-08DNA-binding storekeeper protein-related transcriptional regulator