PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I04453.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 242aa    MW: 25535.6 Da    PI: 6.7505
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I04453.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.38.4e-41611601100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++kll++lpe+ r da+ss+vyeAear+rdPvyG++g + +lq+q ++lk++la
  Pahal.I04453.1  61 PCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNIIKLLQDLPESSRADAVSSMVYEAEARLRDPVYGCAGAVCRLQKQANELKVQLA 155
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++ 
  Pahal.I04453.1 156 RAQAD 160
                     99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.46360161IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-4161158IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MDYGSGSTGT GTTTTTTTTQ QQYSSCRSVS PPSRVSSCSP PPPPPAMQVV GNAPPTLVLS  60
PCAACKILRR RCADGCVLAP YFPPTEPAKF TTAHRVFGAS NIIKLLQDLP ESSRADAVSS  120
MVYEAEARLR DPVYGCAGAV CRLQKQANEL KVQLARAQAD LLNAQAQHAN LLALVCIEMA  180
NRRDSNHHQQ QHQPPSPPLM DGGGGGGGGG CSDFGAAAYQ AFYDSDMDSA TWPDHEAQLW  240
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-416016310113LOB family transfactor Ramosa2.1
5ly0_B2e-416016310113LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9539371e-168EU953937.1 Zea mays clone 1449845 LOB domain protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796704.11e-180LOB domain-containing protein 1-like
SwissprotQ9LQR06e-63LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A2S3IRL91e-178A0A2S3IRL9_9POAL; Uncharacterized protein
STRINGPavir.Ib01336.1.p1e-129(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-54LOB domain-containing protein 1