PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I04198.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 390aa    MW: 43035.6 Da    PI: 9.52
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I04198.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.82.9e-292070252
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52
                    prlrWtp+LH+rFv+a+++LGG++kAtPk++l++m+v gLt++hvkSHLQ+
  Pahal.I04198.1 20 PRLRWTPDLHRRFVQAIHNLGGQHKATPKRVLQMMGVGGLTISHVKSHLQM 70
                    8*************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6731678IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-271672IPR009057Homeodomain-like
SuperFamilySSF466896.45E-141870IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-222070IPR006447Myb domain, plants
PfamPF002493.8E-92170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MAGRERVEGA VRQYNRSKVP RLRWTPDLHR RFVQAIHNLG GQHKATPKRV LQMMGVGGLT  60
ISHVKSHLQM QQVVDRTQMF AGGVRVWTDM AEQDQHGYYC WWCCYSQKES LLHDLQLKRL  120
ISHVRELFHS LFSHGDRLIA VRSTSSRCKN SAFLLHAQRV KAPSDIPTIL LYLEPEETFL  180
PCRPVSDSEM RTTQKARLQL QVQRQEGLLR GHGMRDGDVP FGMRCGRRSD YHHQAGVGYH  240
CTRATVDEGQ QLRSRAWRCP TPTAAAADGG EQHAAPAPDT PPGPLCFLQG GEAICGHDAT  300
AGNSRWPAAV KKRGGEDRER SSPSLSLTLD SGCCGSRDEA DSGRRNSQGS FASSPSTGSA  360
GRGARGCSGQ HGGRDRISLD LSLSMPMYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-152169351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-152169351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-152169351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-152169351Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2T8I4621e-142A0A2T8I462_9POAL; Uncharacterized protein
STRINGPavir.J33581.1.p1e-144(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76102950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-24G2-like family protein