PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I03937.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 354aa    MW: 38595.5 Da    PI: 6.7096
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I03937.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-5261331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd+++ 
  Pahal.I03937.2   6 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATATGYWKATGKDRRIA 99 
                     79****************************.99**************95334445667************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + +g + gl+ktLvfy+grap ge+tdWvmheyrl
  Pahal.I03937.2 100 C-DGGVYGLRKTLVFYRGRAPGGERTDWVMHEYRL 133
                     *.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-603155IPR003441NAC domain
PROSITE profilePS5100557.016156IPR003441NAC domain
PfamPF023655.3E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRKVDN LKIELEVIPV IDLYKSEPWE LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATATGYWK ATGKDRRIAC DGGVYGLRKT LVFYRGRAPG  120
GERTDWVMHE YRLCQDLAHG ACNFIGAYAL CRVIKRHEAG LLQGEPAAKV KGASNAAGGR  180
GQMSKVSSSS SLVSSEQLSA FTPTNSSPPP PTLDMSRGMC TMAESGNTYQ SPLAYGGDAT  240
ATATTGLPSS PLPPPLFMPS DHSSPHDTFF IGDVFPAESR SHAPPLFGGG DMGMGAVEHE  300
LRWDSFAYPN TFSNGAEMWN AAASPMLCRQ ASDGGGVDDL AAFFFSEDNR IVF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51116012169NO APICAL MERISTEM PROTEIN
1ut4_B2e-51116012169NO APICAL MERISTEM PROTEIN
1ut7_A2e-51116012169NO APICAL MERISTEM PROTEIN
1ut7_B2e-51116012169NO APICAL MERISTEM PROTEIN
3swm_A3e-51116015172NAC domain-containing protein 19
3swm_B3e-51116015172NAC domain-containing protein 19
3swm_C3e-51116015172NAC domain-containing protein 19
3swm_D3e-51116015172NAC domain-containing protein 19
3swp_A3e-51116015172NAC domain-containing protein 19
3swp_B3e-51116015172NAC domain-containing protein 19
3swp_C3e-51116015172NAC domain-containing protein 19
3swp_D3e-51116015172NAC domain-containing protein 19
4dul_A2e-51116012169NAC domain-containing protein 19
4dul_B2e-51116012169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792378.10.0NAC domain-containing protein 71-like
TrEMBLA0A2S3INE40.0A0A2S3INE4_9POAL; Uncharacterized protein
STRINGPavir.Ia03491.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-82NAC domain containing protein 71