PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I03377.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 294aa    MW: 32344.2 Da    PI: 4.8927
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I03377.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.6e-1969122356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++ ++q+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  Pahal.I03377.1  69 KKRRLAADQVRALERSFEVDNKLDPERKARIARDLSLHPRQVAVWFQNRRARWK 122
                     4557899**********************************************9 PP

2HD-ZIP_I/II124.45.4e-4068160193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl+++qv++LE+sFe ++kL+perK+++ar+L l+prqvavWFqnrRAR+ktkq+E++++aL++++dal++e ++L++++++L++e++e
  Pahal.I03377.1  68 EKKRRLAADQVRALERSFEVDNKLDPERKARIARDLSLHPRQVAVWFQNRRARWKTKQIEREFAALRARHDALRAECDALRRDKDALAAEIRE 160
                     69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-1862126IPR009057Homeodomain-like
PROSITE profilePS5007116.47164124IPR001356Homeobox domain
SMARTSM003896.0E-1967128IPR001356Homeobox domain
PfamPF000463.5E-1669122IPR001356Homeobox domain
CDDcd000864.46E-1669125No hitNo description
Gene3DG3DSA:1.10.10.605.3E-1975123IPR009057Homeodomain-like
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PfamPF021833.1E-14124165IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MKRPTTRGSS MVSQATTDQQ EDSCRYMERH GVDGDGTAAA ERDDVEAGAY DEEEDDEELA  60
GSRGGLGEKK RRLAADQVRA LERSFEVDNK LDPERKARIA RDLSLHPRQV AVWFQNRRAR  120
WKTKQIEREF AALRARHDAL RAECDALRRD KDALAAEIRE LREKVERQMD VKLESAEEML  180
PVAAGTAAAV ATVYKDGSTD SDSSAVFNEE ASPYSGAAFD HQHQHQPHPS FTGFTSFLAS  240
SSSLNSSFPS SLYHGVSHLD QEADGFLSAT AAHGFFADEQ GSGLGSWYGG EGW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116124RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0420270.0BT042027.1 Zea mays full-length cDNA clone ZM_BFb0113G23 mRNA, complete cds.
GenBankKJ7275560.0KJ727556.1 Zea mays clone pUT5416 HB transcription factor (HB127) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792352.10.0homeobox-leucine zipper protein HOX8-like isoform X1
SwissprotQ338Z73e-95HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A2S3IMB30.0A0A2S3IMB3_9POAL; Uncharacterized protein
STRINGPavir.J35191.1.p1e-175(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-29homeobox protein 16
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]