PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I02557.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 290aa    MW: 30778.4 Da    PI: 7.0486
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I02557.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.25.1e-4271061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvh++FGasnv+kll++lp+ +reda++sl+yeAear+rdPvyG+v+ i+ lq +++q++ +la
  Pahal.I02557.1   7 PCAACKLLRRKCTQGCVFAPYFPPDNPAKFANVHRVFGASNVSKLLNELPQAQREDAVNSLAYEAEARLRDPVYGCVSYISVLQLRIKQARDDLA 101
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Pahal.I02557.1 102 AARKE 106
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4746107IPR004883Lateral organ boundaries, LOB
PfamPF031957.8E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DNPAKFANVH RVFGASNVSK LLNELPQAQR  60
EDAVNSLAYE AEARLRDPVY GCVSYISVLQ LRIKQARDDL AAARKELAGY IGPAAFAPFV  120
APPQYHHHHH HQYAGVPLAA GMGLGVGVAQ PQHGHGHGHP HQQIMVQHQH LHHQQQMAEA  180
QQLAAAVEVA REQDLMMRQA AAYAHAVPGS SAGATVAVVP PDAVPYEGGF LFQQQQPQPS  240
QAQTAVALTY QMEQSPPPSS SGQSHPEVSH QQNTDGSDEG SGGGGVPPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-4841108114LOB family transfactor Ramosa2.1
5ly0_B5e-4841108114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794967.10.0protein ASYMMETRIC LEAVES 2-like
TrEMBLA0A2S3IK580.0A0A2S3IK58_9POAL; Uncharacterized protein
STRINGSi036905m1e-147(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-58ASYMMETRIC LEAVES 2-like 1