PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I02525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 422aa    MW: 45541.8 Da    PI: 10.7139
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I02525.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.6e-31146199255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Pahal.I02525.1 146 PRMRWTTALHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 199
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15143199IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28143199IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-23146199IPR006447Myb domain, plants
PfamPF002493.6E-7147198IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MSYATHDLIT KIHFSSNNKN RHGSILNSEV PQKPAMAATA AATDLSLHIS PPPPPDAGSS  60
GGRGEACHET ADGSFFAKPP KLCLGLETAT AAQQDGQCDV VQQQRLHQPS QIQRFKKSSS  120
SAALSGGTTR SGNGGGGGTK RSSRAPRMRW TTALHAHFVH AVELLGGHER ATPKSVLELM  180
NVKDLTLAHV KSHLQMYRTV KGTTADRSCA AGHVQMRDMG FLQRACEVNA AFEAFNHSTS  240
NTRMMASSAR SSPAGKQEFA WCLRAPLAQQ QSGLPLPLPL PCPYLMSAHH NRYLLSQDHQ  300
GWRRGAQQDV AASRVLRQDD NTARRLHAGH ADAAIRRSSW SAGVASRWSS SSSTAGTGRS  360
SGSSREQACW MMNKQQQQQQ QQQAPSSRVA APNLEISLGR QGWQHSLQDQ QQRSGERANP  420
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-16147201357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-16147201357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-16147201357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-16147201357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9444001e-125EU944400.1 Zea mays clone 217622 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795942.10.0uncharacterized protein LOC112876113
TrEMBLA0A2S3IK230.0A0A2S3IK23_9POAL; Uncharacterized protein
STRINGPavir.Ia01264.1.p1e-117(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.22e-32G2-like family protein