PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I02374.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 119aa    MW: 13581.6 Da    PI: 5.508
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I02374.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like591e-18559155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    k  lrW+ +LH  Fv+ v+  G ++ +  k+++e+m+v gLt++++kSHLQ+YR 
  Pahal.I02374.1  5 KSHLRWSDDLHMIFVKTVAYQGEAKPTALKEMMEAMGVRGLTIQNIKSHLQRYRE 59
                    5689*****************88888889*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.88E-11261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-19360IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-14560IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MQPAKSHLRW SDDLHMIFVK TVAYQGEAKP TALKEMMEAM GVRGLTIQNI KSHLQRYREK  60
CELGAEAPAV EIMNNFLMDD IELTVIDEYI ADLANYAFGH LWFHSQDMSL LSHLSERV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797593.13e-48myb family transcription factor PHL12-like
RefseqXP_025797594.13e-48myb family transcription factor PHL12-like
TrEMBLA0A3L6SBR97e-64A0A3L6SBR9_PANMI; Uncharacterized protein
STRINGPavir.Ia01117.1.p7e-62(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP154991216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.19e-12G2-like family protein