PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I02348.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 200aa    MW: 20656.3 Da    PI: 7.8241
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I02348.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.23.2e-44291281100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cv+apyfp  +p+kfanvhk+FGasnv+kll+++p ++r da+sslvyeA+ar+rdPvyG+vg i++lqqq+e l+a+la
  Pahal.I02348.1  29 PCAACKLLRRRCAASCVFAPYFPPGEPHKFANVHKVFGASNVSKLLQEIPAQHRGDAVSSLVYEANARVRDPVYGCVGAISSLQQQVEALQAQLA 123
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  Pahal.I02348.1 124 LAQAE 128
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.87928129IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4329126IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MRDEVAVATP GGGRAGGGGG GGAASAPAPC AACKLLRRRC AASCVFAPYF PPGEPHKFAN  60
VHKVFGASNV SKLLQEIPAQ HRGDAVSSLV YEANARVRDP VYGCVGAISS LQQQVEALQA  120
QLALAQAEVV RLKMSNDYIV HRLKAARGGG GGGSSYAGSP SSMSSPKTAE PEAHCKATPE  180
LLDMVVDQPD MDDAQFWSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-492813110113LOB family transfactor Ramosa2.1
5ly0_B3e-492813110113LOB family transfactor Ramosa2.1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11119GGRAGGGGG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0699110.0BT069911.1 Zea mays full-length cDNA clone ZM_BFb0321D10 mRNA, complete cds.
GenBankKJ7276500.0KJ727650.1 Zea mays clone pUT5577 LOB transcription factor (LOB19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025791513.11e-144LOB domain-containing protein 4-like isoform X2
SwissprotQ8LBW33e-56LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2S3IJK71e-143A0A2S3IJK7_9POAL; Uncharacterized protein
STRINGPavir.Ib04170.1.p3e-95(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-36LOB domain-containing protein 4
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]