PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I02060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GeBP
Protein Properties Length: 322aa    MW: 34328.3 Da    PI: 9.2543
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I02060.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57384.31.7e-2680174297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++ ql+eK+rrLK+K++  +++++ g +p+  ++hd+++++l++++W
  Pahal.I02060.1  80 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRAQLSEKLRRLKNKYRSVSARVAGGLDPARLAPHDRDVLHLCSRLW 173
                     79*******************.556878888**************************************************************** PP

          DUF573  97 g 97 
                     +
  Pahal.I02060.1 174 D 174
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.6E-2481174IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MASGQQALPV PAPVPPNPNP TAPADPTPPA GARKLPIKRR SPRPSSSPPS SSSPASSDPL  60
RAPAAGGGGA GSDQQQPPFK FQRIWSESDE LRFLQGLLGC GAQGLVFPRD LNVFYDRFSE  120
SMPQPYTRAQ LSEKLRRLKN KYRSVSARVA GGLDPARLAP HDRDVLHLCS RLWDPANAAT  180
SPFTSGGGAS GNKRRRANPR GTQLLAPDAS GDSNSHDYNG EQPEDVVALP NGNNGIGNEI  240
GDHKVVVPCS NEHRMANAVL DVFEECLREA KASGIINNGN VGGSAEESEL AKRWRVQRMD  300
ELHVLSRRLR LLVEDAAAAG H*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9677790.0EU967779.1 Zea mays clone 306034 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143574.11e-160uncharacterized protein LOC100276272
TrEMBLB6T7U51e-160B6T7U5_MAIZE; Putative uncharacterized protein
STRINGSi036257m1e-158(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.23e-12DNA-binding storekeeper protein-related transcriptional regulator