PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I00766.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 315aa    MW: 34347.6 Da    PI: 4.599
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I00766.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.2e-1967119456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++++  eq+++Le++Fe +++++ +++ ++A+ lgL+ rqV vWFqNrRa++k
  Pahal.I00766.1  67 KRRLALEQVRALERCFETDNKLDPDRKSRIARDLGLQPRQVAVWFQNRRARWK 119
                     4467789*********************************************9 PP

2HD-ZIP_I/II124.93.6e-4065157193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl+ eqv++LE++Fe+++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktk lE+d++aL+++++al+++ ++L++++++L++e++e
  Pahal.I00766.1  65 EKKRRLALEQVRALERCFETDNKLDPDRKSRIARDLGLQPRQVAVWFQNRRARWKTKTLERDFAALRARHEALRADCDALRRDKDALAAEIRE 157
                     69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-1863121IPR009057Homeodomain-like
SMARTSM003895.7E-1964125IPR001356Homeobox domain
PROSITE profilePS5007116.35865121IPR001356Homeobox domain
CDDcd000861.92E-1666121No hitNo description
PfamPF000461.4E-1667119IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.2E-2073120IPR009057Homeodomain-like
PRINTSPR000314.2E-592101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000314.2E-5101117IPR000047Helix-turn-helix motif
PfamPF021833.3E-13121162IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MKRQSKRPAS SHESTEEGEK LAFAEDEALK ARNTEHDEAE LDDVDDDEDE LAGGRAARST  60
CGLGEKKRRL ALEQVRALER CFETDNKLDP DRKSRIARDL GLQPRQVAVW FQNRRARWKT  120
KTLERDFAAL RARHEALRAD CDALRRDKDA LAAEIRELRQ KLSKPETAVK LEAAANDAAE  180
ERQATVGASA AALCSKDGSS DSDSSVVFND VEASPYSGAA FEQPAFAGFG APFLDTSAAT  240
TCCSSLSMFD TKWQQAPAYP YDSYKSGGGY GFTEEWLASS DVIGSGDGAA SFFSEEHASS  300
LNFGWCASGT EAWE*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699250.0JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798128.10.0homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-106HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A2S3ITF90.0A0A2S3ITF9_9POAL; Uncharacterized protein
STRINGPavir.Ia04906.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.27e-29homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]