PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I00274.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 927aa    MW: 103056 Da    PI: 5.5227
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I00274.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.62.5e-28607657252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Pahal.I00274.1 607 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 657
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.006596677IPR003035RWP-RK domain
PfamPF020424.4E-26609657IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2404.4E-24825909No hitNo description
SuperFamilySSF542771.18E-21826908No hitNo description
SMARTSM006663.1E-22828911IPR000270PB1 domain
PROSITE profilePS5174521.818828911IPR000270PB1 domain
PfamPF005641.1E-15829910IPR000270PB1 domain
CDDcd064077.52E-40829909No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 927 aa     Download sequence    Send to blast
MEQPAARKDE DALLGYAVME DVAVGDLDLM EELFMAAPGF DFSDFSQPGA GAPPGACFSP  60
LFDICSTTTT ATPPAPAGED DRDDAERERA DRPEADAAAP PRRAWLFQPG QEVAATVKER  120
LRRALERIAS LSQTQPGELL AQVWVPTLIG DRQVLTTCGQ PFWLDSRNQR LANYRSVSMK  180
YQFSADESAR AELGLPGRVF VGRVPEWTPD VRYFSTEEYP RVRHAQSLDI RGSVALPIFE  240
PRTRACLGVI ELVMTTQKIN YNAEVENICS ALKEVDLRST DVSSDTHANV TDTSYRAVVP  300
EIIDVLRTVC ERHELPLAQT WIPCICQAKR GSRHSDEKLK YCVSTVDEAC YVRDLAVKSF  360
HQACSDHHLF RGEGVVGRAF GTNEPCFSQD ITSYSKAQYP LSHHAKLFSL RAAVAIRLRS  420
IRTGSLDYVL EFFLPVDCIE SEEQRAMLNS LSITIQQTCY TLRVVSLKEL VDEGSFETST  480
LTPAEFYDKP THENLDEVCS NIEVPARTTS LGTSEEVSSW IASLVDAQSK GAKEMDGDLP  540
FGFSKQEDEG FSVTAGWHTS PVLRQKGSIF SGFKQHEEYE VKEPICSRGP SPSNVDKTVE  600
KRRTKMEKTV SLEELRKHFA GSLKEAAKNL GVCPTTLKRI CRQHGINRWP SRKIKKVGHS  660
LKKLQMVIDS VHGAEGTVQL SSLYENFTKT TWSERELQGD GNYPLSEQKG HLEPSVPDRQ  720
CEGRFTSHTS GSNSLSPSCS QSSNSSHGCS SGSKSQQNGS APQLAVKQEV LMEENQSSTL  780
LKAASHAELQ MFTEERPVTL PRSHSQMLLS EQKPVENMSG MQKSKPDSLK IKAMYGEERC  840
IFRLQPSWGF EKLKEEIVKR FSIAQEMYVD LKYLDDESEW VLLTCDADLL ECIDVYKSSS  900
AQTVRILVNV NVQPVLGPSF GQTGLS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797092.10.0protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A2S3IUM40.0A0A2S3IUM4_9POAL; Uncharacterized protein
STRINGSi034133m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]