PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I00254.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 368aa    MW: 39859.6 Da    PI: 9.6803
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I00254.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17e-322578255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ+YR 
  Pahal.I00254.1 25 PRLRWTPDLHHCFVHAIHKLGGQDKATPKRVLQLMGVGGLTISHVKSHLQMYRN 78
                    8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6532181IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-312181IPR009057Homeodomain-like
SuperFamilySSF466896.27E-162380IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-242578IPR006447Myb domain, plants
PfamPF002497.0E-102677IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MTMVRTVVGR ERSGGVRQYN RSKVPRLRWT PDLHHCFVHA IHKLGGQDKA TPKRVLQLMG  60
VGGLTISHVK SHLQMYRNMR NDLGMQGSTM QQVPRPDQEH LYGGSGMHME LCSQDTQQQQ  120
WDHECDGPCC CICRSPKPRK EPMLPLLLHP QLKRTETRRE REEEEDYGGN ASPKSLLRGP  180
GPGICEGDGS SPPRLYCALA AAAGGYNYMR IMQAAMGGMA AAPGAPPPHA EPEVEPLQGA  240
GIKRQRHEAR PAAACGGHAA PAPPPNKLFT FLGFVVAPGP AACRRDHPFE IASRTRVPRT  300
ANRLPCSVDT PSNKAVVRRG ANNPPPSRAV LHARRRGGQP AVADDVVGGE PDQPRPVAVH  360
VELTSAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-172680357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-172680357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-172680357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-172680357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0689101e-110BT068910.1 Zea mays full-length cDNA clone ZM_BFc0191L18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792174.10.0uncharacterized protein LOC112873442
TrEMBLA0A2T8I6K30.0A0A2T8I6K3_9POAL; Uncharacterized protein
STRINGPavir.Ia04483.1.p1e-172(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76102950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.14e-27G2-like family protein