PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I00222.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 361aa    MW: 39990.5 Da    PI: 4.9275
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I00222.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.24.4e-5581371129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk+v
  Pahal.I00222.2   8 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQEhcgIGYEEQNEWYFFSYKDRKYPTGTRTNRATMAGFWKATGRDKAV 101
                     69****************************.9***************953543334677************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Pahal.I00222.2 102 HD-KSRLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 137
                     **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-606157IPR003441NAC domain
PROSITE profilePS5100559.3158157IPR003441NAC domain
PfamPF023651.6E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MDSMESCVPP GFRFHPTDEE LVGYYLRKKV ASQKIDLDVI RDIDLYRIEP WDLQEHCGIG  60
YEEQNEWYFF SYKDRKYPTG TRTNRATMAG FWKATGRDKA VHDKSRLIGM RKTLVFYKGR  120
APNGQKTDWI MHEYRLETDE NAPPQEEGWV VCRAFKKRTA YPARSMAMAW DSSYSYREVS  180
VMGAAAAEAA AFVDPNAAYA QIRRESKSAR FKQESELDGA AALLQYSSHL VELPQLESPS  240
APLAPNPSQA SSADEVDGAD SGRRGKKARS DRMATDWRAL DKFVASQLSP TECGGGSLEA  300
TASAAAANNV GSQLDHGEDD DDMAALLFLN SDGREEAERW TGLLGPAGGD GDFGLCVFEK  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-50516112172Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0750870.0KT075087.1 Panicum virgatum secondary wall NAC master switch (SWN5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796192.10.0NAC domain-containing protein 37-like
SwissprotQ9SL411e-137NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A2S3IUN60.0A0A2S3IUN6_9POAL; Uncharacterized protein
TrEMBLA0A2T7CIA30.0A0A2T7CIA3_9POAL; Uncharacterized protein
STRINGSi036363m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-134vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]