PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H02316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 371aa    MW: 40105.7 Da    PI: 7.3877
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H02316.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC70.42.2e-22128172145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     daepgrCrRtDGKkWRCsr++++++k+CErH++r+++rsrk++e+
  Pahal.H02316.1 128 DAEPGRCRRTDGKKWRCSRDAVGDQKYCERHIKRNCHRSRKHVES 172
                     79****************************************996 PP

2QLQ57.25.2e-2068104137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FT++Q+++L++Q+l+yK++a n+PvP+ Ll++i++
  Pahal.H02316.1  68 GPFTPTQWMELEHQALIYKHFAVNAPVPSSLLLPIRR 104
                     59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.4E-1268104IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.46469104IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.3E-1469103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.468128172IPR014977WRC domain
PfamPF088792.2E-17129171IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
METGRDGFFG AAERASPPPP SCSFLGSAAA TTGSGGAQML SFSSSGAAGL GLSSGASKMQ  60
GVLSRVRGPF TPTQWMELEH QALIYKHFAV NAPVPSSLLL PIRRSINPWS GLGSSSLIWT  120
PFRPGSGDAE PGRCRRTDGK KWRCSRDAVG DQKYCERHIK RNCHRSRKHV ESRKATPTIA  180
EPSLAVSGGP SLHSYAVPWQ QQVKSSAANV TDPFSRESNR KLLEKQNVHS QLSVSTPMDS  240
FDFSTSGSSQ NRDIVALSPV EFQHDHDQAY LVHGVGSSAE NDNDLQESLL LVSRETLDDG  300
PLGEVFKSKS CQSAYTDILT DQWTATHDMH SPTGILQLSN SNTMPVENHI NSNDYLMATM  360
VNAQTVPTFL *
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025827128.10.0growth-regulating factor 8-like isoform X1
SwissprotQ6AWY11e-149GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLA0A2S3IEP90.0A0A2S3IEP9_9POAL; Uncharacterized protein
STRINGPavir.Hb00712.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129602731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-43growth-regulating factor 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]