PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H01830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ARF
Protein Properties Length: 851aa    MW: 94180.6 Da    PI: 6.6488
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H01830.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.81e-23145246199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++ +++a+e+       +++++ ++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   + ++
  Pahal.H01830.1 145 FCKTLTASDTSTHGGFSVLRRHADEClppldmRHQPPT-QELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--RGEN 236
                     99*****************************8444444.59************************************************..4499 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+v+v+r+
  Pahal.H01830.1 237 GELRVGVRRA 246
                     99*****996 PP

2Auxin_resp105.94.5e-35271353183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+st+++F+v+Y+Pr+s++eFvv++++++++lk+++ +GmRfkm+fe+e+++e+r++Gt+vg  d d+  W +SkWr Lk
  Pahal.H01830.1 271 AWHAVSTGTMFTVYYKPRTSPAEFVVPYDRYMESLKRNYPIGMRFKMRFEGEEAPEQRFTGTIVGNVDPDQAGWAESKWRYLK 353
                     89******************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.8E-41138260IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.06E-40140274IPR015300DNA-binding pseudobarrel domain
CDDcd100176.13E-22143245No hitNo description
PfamPF023621.6E-21145246IPR003340B3 DNA binding domain
PROSITE profilePS5086311.801145247IPR003340B3 DNA binding domain
SMARTSM010191.2E-23145247IPR003340B3 DNA binding domain
PfamPF065071.4E-32271353IPR010525Auxin response factor
PfamPF023091.9E-11719809IPR033389AUX/IAA domain
PROSITE profilePS5174521.545722806IPR000270PB1 domain
SuperFamilySSF542772.5E-11723798No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MASSAAAAGG GGGRDEDGAA AAQGGGGGGG GAEDGMYAEL WNLCAGPLVT VPRVGDKVYY  60
FPQGHIEQVE ASTNQVAKQH MQLYDLPWKI LCEVMNVELK AEPDTDEVYA QLTLLPESKP  120
DENGSSEEMP AGPPAAPVRP HVRSFCKTLT ASDTSTHGGF SVLRRHADEC LPPLDMRHQP  180
PTQELVAKDL HGVEWRFRHI FRGQPRRHLL QSGWSVFVSA KRLVAGDAFI FLRGENGELR  240
VGVRRAMRQQ ANVPSSVISS HSMHLGVLAT AWHAVSTGTM FTVYYKPRTS PAEFVVPYDR  300
YMESLKRNYP IGMRFKMRFE GEEAPEQRFT GTIVGNVDPD QAGWAESKWR YLKVRWDEAS  360
SIPRPERVSP WQIEPAVSPP PINPLPVHRP KRPRSIATAS LTDSSAPTTT KEVAPKVTAE  420
TQQNVVQRTF QIQDNATLRS TFGDKSELNA AQESALQLSG FDQEKSTIDT QRKLGSDSWM  480
QMNRYESYNE MLSGYQQPKD LQNQQGFCSL PDQIAAGRPN FWHTVNAHYQ DQQGNHNMFG  540
SWSMMPSSTG FGLNRQNYPT IQEVGRLPQT SANTEFGNGV YTTLSGRGID QYSAGWFGRM  600
VPGSRLDDAQ TRMVKPQPLV LAHGEAQKMK GNSCKIFGIH LDSPAKSEPL NSPPSVAYDG  660
MPQAPAAHEW RRVDTEVEKC SDTSKMAKQL DAPQADPILK KHLSCPQASR STECKSHGGS  720
TRSCKKVHKQ GIALGRSVDL TKFKGYMELV AELDEMFDFN GELKDSNKEW MVVYTDNEGD  780
MMLVGDDPWD EFCNMVHKIF IYTREEVQRM SPGNLNSRSE DSPANSTERG SAVRETHGCL  840
PTSSLNSENC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-171193752354Auxin response factor 1
4ldw_A1e-171193752354Auxin response factor 1
4ldw_B1e-171193752354Auxin response factor 1
4ldx_A1e-171193752354Auxin response factor 1
4ldx_B1e-171193752354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826989.10.0auxin response factor 23-like isoform X2
SwissprotA2ZET60.0ARFW_ORYSI; Auxin response factor 23
TrEMBLA0A2S3IEH10.0A0A2S3IEH1_9POAL; Auxin response factor
STRINGSi025988m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117836111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2