PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H01581.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 178aa    MW: 19177.5 Da    PI: 6.7455
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H01581.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601154.8e-36191191101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk +rr+C++dC+lapyfpa++p+++a v+++FGasnv ++l++lp +er +a++ ++ eA+ r++dPvyG++g++++lq +++ ++ ela
  Pahal.H01581.1  19 RCAACKNQRRRCSQDCILAPYFPASDPQRYASVQRVFGASNVARMLQDLPIHERGKAADIMAVEAHRRVQDPVYGCAGIVSRLQGEIRAVQCELA 113
                     6********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++++++
  Pahal.H01581.1 114 RTQAQI 119
                     *99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.6518119IPR004883Lateral organ boundaries, LOB
PfamPF031958.5E-3619116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MSTSSNTEAD AGASPGIRRC AACKNQRRRC SQDCILAPYF PASDPQRYAS VQRVFGASNV  60
ARMLQDLPIH ERGKAADIMA VEAHRRVQDP VYGCAGIVSR LQGEIRAVQC ELARTQAQIA  120
VHATAAARAR PAVGTAQLNA PAQAALTQQQ QEQDDALVMQ QDPFQGLDAL LVDDYSVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-312012312115LOB family transfactor Ramosa2.1
5ly0_B2e-312012312115LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025791709.11e-126LOB domain-containing protein 24-like
SwissprotQ8LBW31e-38LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2T8I2E11e-125A0A2T8I2E1_9POAL; Uncharacterized protein
STRINGPavir.J05299.1.p2e-80(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-38LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]