PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H00954.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 362aa    MW: 38706.3 Da    PI: 4.8246
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H00954.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.56.4e-5091331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtd+elv++yL +k+ g +l +  vi+evd+yk++Pw+Lp+k++++ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+v s 
  Pahal.H00954.1   9 LPPGFRFHPTDDELVMYYLLRKCGGLPLAA-PVIAEVDLYKFDPWSLPEKAAGGEKEWYFFSPRDRKYPNGSRPNRAAGAGYWKATGADKPVGS- 101
                     79*************************999.89***************999999**************************************99. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + v +kk Lvfy g+ p+g+kt+W+mheyrl
  Pahal.H00954.1 102 -PRPVAIKKALVFYAGKPPRGVKTNWIMHEYRL 133
                     .779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-605164IPR003441NAC domain
PROSITE profilePS5100558.8289164IPR003441NAC domain
PfamPF023651.1E-2510133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MDFGGALQLP PGFRFHPTDD ELVMYYLLRK CGGLPLAAPV IAEVDLYKFD PWSLPEKAAG  60
GEKEWYFFSP RDRKYPNGSR PNRAAGAGYW KATGADKPVG SPRPVAIKKA LVFYAGKPPR  120
GVKTNWIMHE YRLADVDRSA AARKKTNNNA LRLDDWVLCR IYNKKGVIER YDTVDDDEGA  180
AAAADDVKPA ATKNPRGAGG RAPMKVEVAD YGGYYDDYDL ETPSAGMLCF DRPTAAAPVP  240
APAPALAPAP ALSPTEPDPD RDSSSMPWMH TDNSSSGSEH ELSPSPDLPD RDHAESQPGG  300
GGAGWWPGAD WSGAAGDDGF LVLDDGGAAL FGPPSPGLFA RVDVAAAAAF GDMFAYLQRP  360
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-7421708174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses. {ECO:0000269|PubMed:20632034}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by dehydration, salt stress, cold stress, abscisic acid (ABA) and methyl jasmonate. {ECO:0000269|PubMed:20632034}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0699600.0BT069960.1 Zea mays full-length cDNA clone ZM_BFb0347F20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025827492.10.0NAC domain-containing protein 71-like
SwissprotQ53NF71e-150NAC71_ORYSJ; NAC domain-containing protein 71
TrEMBLA0A2S3ICY50.0A0A2S3ICY5_9POAL; Uncharacterized protein
STRINGPavir.Ha00897.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118043039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.15e-92NAC domain containing protein 32
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Sperotto RA, et al.
    Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains.
    J. Plant Physiol., 2010. 167(17): p. 1500-6
    [PMID:20580124]
  3. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  4. Kan CC,Chung TY,Juo YA,Hsieh MH
    Glutamine rapidly induces the expression of key transcription factor genes involved in nitrogen and stress responses in rice roots.
    BMC Genomics, 2015. 16(1): p. 731
    [PMID:26407850]