PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H00249.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 370aa    MW: 41045.3 Da    PI: 6.7559
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H00249.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.85.7e-181352544
                    SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                      s r++t+skRr gilKKA+ELS+LCd+   +++fs++ 
  Pahal.H00249.1 13 HISGRHITYSKRRSGILKKAKELSILCDIPLMLLMFSPSE 52
                    56789********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.035153IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-24160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-22295IPR002100Transcription factor, MADS-box
CDDcd001201.45E-19254No hitNo description
PRINTSPR004041.3E-13323IPR002100Transcription factor, MADS-box
PfamPF003196.9E-161254IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-132338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-133859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGRVKLKIKK LEHISGRHIT YSKRRSGILK KAKELSILCD IPLMLLMFSP SEKPTICIGE  60
KSNIEEIIAK YAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG GQTVEELSSH  120
LGSLQCQMAD VQKRLSYWGD PEKIENIDHI RGMEQSLKES LNRIRIHKEN FAKQHLIGLQ  180
CAAAQFQTDM QLPLGLTGDP GPSSWFQNGG ADGQQTMMLP DDSGLLHQRD IGCSTSTSLQ  240
SYPGYFSMSK QSTDTGGGSE HGQPAVHQQP PDFGQAECLT SLHLGAQFPY TPFDTSLFNE  300
RMFRPDAMEL HDGSAGIDFG GGHFDMPRPG DEASFQNWAS AACGAAMFDH HQQQQHHQQQ  360
QPSSAQQQL*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828481.10.0agamous-like MADS-box protein AGL65
SwissprotQ7X9I02e-82AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A2T7CQS30.0A0A2T7CQS3_9POAL; Uncharacterized protein
STRINGPavir.J04162.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.17e-85AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]