PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H00213.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 547aa    MW: 61862.7 Da    PI: 6.7832
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H00213.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS216.91e-661985382373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL++cA+av+++++  a +lL++++ +as +gd++qR+a+ + + L a   +            + s   ++e l+a++l++ ++ + k++  
  Pahal.H00213.1 198 RTLLISCAQAVATNNHMGACELLKKIKRHASATGDATQRVAHQLWQLLMA---E------------RPS---VVEFLKAYRLYFAACCFNKVALS 274
                     789**************************************997764433...2............233...89********************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgv.pfefnvlvakrle 187
                         +I+ a+ g++++Hi+D++                 ++gp +++iT+++ p +     +e++ee+g rL+k A+e+g+ +f+f++ ++ ++e
  Pahal.H00213.1 275 FSTMTIYHAMVGKRKLHIVDYE-----------------KGGPTEVKITAIAGPPKLkscPAERIEELGCRLSKCAHEFGLaSFKFHT-ITMKWE 351
                     ********************97.................57999*******9887767899*******************957*****.6889** PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                     d+++e+L+++ gE+l+Vn  ++  +l+desv  +s  +rd+vL+ +++++P+v++    ++++ ++sFl+rf e ++yy alfd l+a++pres+
  Pahal.H00213.1 352 DVRIEDLNTDAGEVLVVNDLFNFSTLMDESVFFDSqsPRDTVLSNIRKMRPDVFIQRVLNCSC-GSSFLTRFREVMSYYLALFDILDATMPRESK 445
                     ******************************97766669****************999999999.679**************************** PP

            GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      r+++E+++lgr + n++aceg + +er e++++W+ r ++aG++++pl++++++ +k  ++k++ + + + e+ ++l++gW++r L++ S W
  Pahal.H00213.1 446 SRVVLEQFVLGRPALNIIACEGPDLVERPEKYRQWQVRNQRAGLRQLPLRSRIVEVVKDSVQKHHHKDFLISEDGQWLLQGWMGRVLFAHSTW 538
                     *****************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098532.658171519IPR005202Transcription factor GRAS
PfamPF035143.6E-64198538IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MTLPYISRVL LEDDVDDKLD DHPALLQVQQ PFAQILSSSS YGTSTGNAEG AKELLQDGSD  60
DESTFNLNSA LSKGTDAVRA FLKGMEEANM LLPKDNKFRG DVPVNQMVQE SSNHSGDKKR  120
YDRDNHTEEE IRTSKTAKMI KDPEENCANE MLDEMMLHAY ETCIRGMDEL RASMDSKVEK  180
ENRKNCSKAA KGNVVDIRTL LISCAQAVAT NNHMGACELL KKIKRHASAT GDATQRVAHQ  240
LWQLLMAERP SVVEFLKAYR LYFAACCFNK VALSFSTMTI YHAMVGKRKL HIVDYEKGGP  300
TEVKITAIAG PPKLKSCPAE RIEELGCRLS KCAHEFGLAS FKFHTITMKW EDVRIEDLNT  360
DAGEVLVVND LFNFSTLMDE SVFFDSQSPR DTVLSNIRKM RPDVFIQRVL NCSCGSSFLT  420
RFREVMSYYL ALFDILDATM PRESKSRVVL EQFVLGRPAL NIIACEGPDL VERPEKYRQW  480
QVRNQRAGLR QLPLRSRIVE VVKDSVQKHH HKDFLISEDG QWLLQGWMGR VLFAHSTWVA  540
EDISSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-182015388374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677893.10.0PREDICTED: scarecrow-like protein 33 isoform X3
TrEMBLK7TQL60.0K7TQL6_MAIZE; GRAS transcription factor
STRINGGRMZM2G106356_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.14e-98GRAS family protein