PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H00105.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 1528aa    MW: 167903 Da    PI: 4.7638
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H00105.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS333.24.7e-1024137791367
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++ L++cA+ v++gd + a +lL ++++++sp+gd++qR+a++f+e+L+arla+++s++y++l +++ts   ++e l+a+klf  +s + k+  
  Pahal.H00105.1 413 LRTMLIHCAQSVATGDRRSAMELLRQIKQHSSPRGDATQRMAHCFAEGLEARLAGTGSQVYQSLMAKRTS---VVEFLKAYKLFMAASSLKKVHI 504
                     5789************************************************************999999...********************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +  Nq+Il+av+g +++Hi+ +++ +GlQWp Ll+ L+ R++gpp++R Tg++ p++g   + ++eetg+rL++ A e+gvpf+f++ +a ++e+
  Pahal.H00105.1 505 MFSNQTILDAVAGRSKLHIVVYGVHYGLQWPGLLHFLSRREGGPPEVRFTGIDLPQPGfrPAYQIEETGRRLSNCALEFGVPFKFQA-IAAKWET 598
                     *********************************************************99999*************************.799**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                     +  e+L+++p+E+l+V++     +l+desv+++   +rd vL+ +++++P+v+++   +  ++++ Fl+rf eal +ysalfd+l+a++pr+++e
  Pahal.H00105.1 599 VCAEDLNIDPDEVLVVHSECDFSKLMDESVDVDTpsPRDMVLNNIRKIRPNVFILFVMNGTYGAPFFLTRFREALFFYSALFDMLDATIPRDNDE 693
                     ****************************998776669********************************************************** PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                     r  +Er ++gr++ nv+acega+r+er et+++W+ r ++aG+k++pl+ +++k ++  +++++ + + ++e++ +l++gWk+r+L
  Pahal.H00105.1 694 RLLIERDIFGRSALNVIACEGADRVERPETYKQWQVRNHRAGLKQLPLNPEVVKIVRDKVKNYYHKDFLIDEDHRWLLQGWKGREL 779
                     ****************************************************************889*****************98 PP

2GRAS330.72.7e-101114715182373
            GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94  
                       +lL++cA+av++++ + a++lL ++++++sp+gd++qRla++f+e+L+arla+s+s++y++l +++ s   ++e l+a++l+  +s +  ++
  Pahal.H00105.1 1147 STLLIHCAQAVATDNCRSATELLRQIKQHSSPRGDATQRLAHCFAEGLEARLAGSGSQVYRSLMAERIS---VVEYLKAYQLYLAASCFKMMA 1236
                      579************************************************************999998...********************* PP

            GRAS   95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185 
                      +   N +I + ++g ++vHi+D++i++G+QWp+Ll  +a+ ++gpp++RiTg++ p++g   + ++eetg+rL++ A++lgvpf+f+  ++ r
  Pahal.H00105.1 1237 FKFSNMTIFKVIAGRKKVHIVDYGIQYGFQWPSLLGYMATLKGGPPQVRITGIDLPQPGfrPASRIEETGRRLSNCASQLGVPFKFHS-ITAR 1328
                      **********************************************************9*9***************************.699* PP

            GRAS  186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276 
                      +e+++ ++L+++p+E+l+Vn++ +  +l+de v+++s  +rd vL+ + +++P+ +++   +a+++++ F++rf eal ++sa+fd+l+a++p
  Pahal.H00105.1 1329 WETISADDLNIDPDEVLIVNSIRNFGNLMDEGVDIDSpsPRDVVLSNICKMKPDAFILFVMNASYSAPFFVTRFREALFFHSAMFDMLDATAP 1421
                      *********************************9999889***************************************************** PP

            GRAS  277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369 
                      re+++r  vEr l+++ + nvvaceg++r+er et+++W+ r ++aG++++pl+ +++k ++  +r+ + + + ++ ++++l+ gWk+r L++
  Pahal.H00105.1 1422 RENHQRFLVERGLFRKCALNVVACEGSDRVERPETYKQWQVRNRRAGLRQLPLDPDVVKAVREKVREQYHKDFVIDVDHQWLLEGWKGRILYA 1514
                      *********************************************************************888********************* PP

            GRAS  370 vSaW 373 
                      +S W
  Pahal.H00105.1 1515 MSTW 1518
                      **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.509387766IPR005202Transcription factor GRAS
PfamPF035141.6E-99413779IPR005202Transcription factor GRAS
PROSITE profilePS5098558.62811201499IPR005202Transcription factor GRAS
PfamPF035149.5E-9911471518IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1528 aa     Download sequence    Send to blast
MSATPEEFLG QGAYLAAPEP FSPSVFLDLP PTPRPDADDP ASSDDLVLPF ISRMLMEEDI  60
DDKFFYEFPD HPALLNAQQP YAQILLSDES ATNSSSNSSS GGTAANSTLS PSSSSDAPAS  120
AEPAWPYDPI ELSQLLRSPP YSDTVLGLHD FTADDVDALL LQGQGEATAG FHQTPPFLDT  180
GGGGAGGGER QGAVSIAAQN AAGDESPSLA AQNAAGIESS AADEQDTKTT NATTLPAADG  240
DPAALASAFF SGQSGESMDM LNMAFLKGME EAKKFLPTNN SLLIDLEDTS GQSLPRDGKP  300
ATGFAAAQVK EEAVADGMLL FGGSNTGRGR KNCHTDEDLE AETGRNSKLM MPEQEETGAS  360
ELFDELMSCN FDGFLKRMND LRIAMDSESE KSARRVSGKG ARGRQRANEV VDLRTMLIHC  420
AQSVATGDRR SAMELLRQIK QHSSPRGDAT QRMAHCFAEG LEARLAGTGS QVYQSLMAKR  480
TSVVEFLKAY KLFMAASSLK KVHIMFSNQT ILDAVAGRSK LHIVVYGVHY GLQWPGLLHF  540
LSRREGGPPE VRFTGIDLPQ PGFRPAYQIE ETGRRLSNCA LEFGVPFKFQ AIAAKWETVC  600
AEDLNIDPDE VLVVHSECDF SKLMDESVDV DTPSPRDMVL NNIRKIRPNV FILFVMNGTY  660
GAPFFLTRFR EALFFYSALF DMLDATIPRD NDERLLIERD IFGRSALNVI ACEGADRVER  720
PETYKQWQVR NHRAGLKQLP LNPEVVKIVR DKVKNYYHKD FLIDEDHRWL LQGWKGRELE  780
KLRFLTHPHP AAMAATPEGL FADPEPFSPS IFLDLPPTPR PDGIGEGPAS SDDLVLPFIS  840
RMLMEEDMDD NFLYQFTDHP ALLQAQEPYA RILSDANSTA SGSAATLSPS SDYDPVQLLL  900
SPLCPDMGLH DFNNGDVGAF FLPAQDGASP ELEQNPAQSG NAGDANAFVG YGGSTGVQSS  960
AFLDAADEQS PAQLGTTTLP LPAGDGDHAV LALAFFSGQN GGNMDMLNTA FLKGMEEANK  1020
FLPTNNSLLI DLEDTSGQHL PRDSNLSRAF ATIQEEEGRG NGRGRKNRLN WDDLEAETCR  1080
KSKLMVPEPE ETGEKVDEMI VNGRELCLKE MEALRITMGS DAKKNTRKGK GKSAKGMWSA  1140
DEAVDLSTLL IHCAQAVATD NCRSATELLR QIKQHSSPRG DATQRLAHCF AEGLEARLAG  1200
SGSQVYRSLM AERISVVEYL KAYQLYLAAS CFKMMAFKFS NMTIFKVIAG RKKVHIVDYG  1260
IQYGFQWPSL LGYMATLKGG PPQVRITGID LPQPGFRPAS RIEETGRRLS NCASQLGVPF  1320
KFHSITARWE TISADDLNID PDEVLIVNSI RNFGNLMDEG VDIDSPSPRD VVLSNICKMK  1380
PDAFILFVMN ASYSAPFFVT RFREALFFHS AMFDMLDATA PRENHQRFLV ERGLFRKCAL  1440
NVVACEGSDR VERPETYKQW QVRNRRAGLR QLPLDPDVVK AVREKVREQY HKDFVIDVDH  1500
QWLLEGWKGR ILYAMSTWVA DDAISEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-3741715188374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9760950.0EU976095.1 Zea mays clone 622740 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677823.10.0PREDICTED: scarecrow-like protein 34
TrEMBLC5Y8L20.0C5Y8L2_SORBI; Putative uncharacterized protein Sb05g027740
STRINGSb05g027740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-144SCARECROW-like 14