PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H00103.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 627aa    MW: 70105.3 Da    PI: 6.9244
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H00103.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS342.28.9e-1052466172373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                       lLl+cA+av+++d ++a+ lLa+++ ++s++gd+ qRla++f+e+L+arla+++s+ly++l +++ts   +++ l+a++lf  ++ + k+++ 
  Pahal.H00103.1 246 HALLLRCAQAVATDDRRCAHDLLAQVRRHSSSTGDAAQRLAHCFAEGLEARLAGTGSRLYHSLMVRPTS---VVDFLKAYQLFMAACCCKKVAFT 337
                     579*****************************************************************9...*********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                       N++I +av+g +r+Hi+D++i++G+QWp Ll+ La+ ++gpp++RiTg++ p++g   + ++eetg+rL++ A+elgvpf+f+  +a + e++
  Pahal.H00103.1 338 FSNKTIFDAVAGRRRLHIVDYGINYGFQWPGLLRGLAAMQGGPPEVRITGIDLPQPGfrPAYQIEETGRRLTNCARELGVPFKFRG-IAAKRETI 431
                     ********************************************************99999*************************.69999*** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     ++e+L+++p E+l+V++  +  +l+desv l    +rd+vL  +++++P+v+++   +  ++++ F +rf e l y sa fd lea++pr+s+er
  Pahal.H00103.1 432 SPEDLDIDPAEVLVVSSLCHFRHLMDESVVLGRpsPRDQVLGNIRRMRPDVFIHGVINGAYGTTYFPTRFRELLFYTSAQFDLLEATVPRDSQER 526
                     ****************************99876669*********************************************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       +Er ++gr+++nv+acega+r+er et+++W++r ++aG++++pl+ +++k +   ++  + + + v+e++ +l+  Wk+r L+ +S W
  Pahal.H00103.1 527 LLIERDIFGRSAMNVIACEGADRVERPETYKQWQARNQRAGLRQLPLKPQVVKVVLDKVKDNYHKDFVVDEDQSWLLHRWKGRVLYGLSTW 617
                     ***************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.128219598IPR005202Transcription factor GRAS
PfamPF035143.1E-102246617IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MAAAPEEFLF VHPEPPSPSV FLDLPPTPRR DDPAAFDDMA LPYIARLLMD EEAAGEDSFF  60
YQYPDHPALL QAQLPFAQIL SENTASPSVS ADTEARRGSS DSDHSPTLGS PAADHATDMV  120
TSAFLKGMEE ATKFLPTNYA LLLNHNSVDE AVNGGHARGR KNNRHAAGYE YDDADPEQKA  180
RRATKLVAPE PDEDGARQMF DDMMLRERDI CMKGAQQRLT VDANHKAPRR RRRRGGTSTD  240
DAVDLHALLL RCAQAVATDD RRCAHDLLAQ VRRHSSSTGD AAQRLAHCFA EGLEARLAGT  300
GSRLYHSLMV RPTSVVDFLK AYQLFMAACC CKKVAFTFSN KTIFDAVAGR RRLHIVDYGI  360
NYGFQWPGLL RGLAAMQGGP PEVRITGIDL PQPGFRPAYQ IEETGRRLTN CARELGVPFK  420
FRGIAAKRET ISPEDLDIDP AEVLVVSSLC HFRHLMDESV VLGRPSPRDQ VLGNIRRMRP  480
DVFIHGVING AYGTTYFPTR FRELLFYTSA QFDLLEATVP RDSQERLLIE RDIFGRSAMN  540
VIACEGADRV ERPETYKQWQ ARNQRAGLRQ LPLKPQVVKV VLDKVKDNYH KDFVVDEDQS  600
WLLHRWKGRV LYGLSTWVAD DATSSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-432496178374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1228233RRRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012703949.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK3ZHR40.0K3ZHR4_SETIT; Uncharacterized protein
STRINGSi026116m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-137GRAS family protein