PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H00102.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 301aa    MW: 32569.7 Da    PI: 5.9993
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H00102.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS55.21.5e-17212298393
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                     ++Ll+cA+av + d + a++lL++++ +asp+gd++qRla +f+++L+arla+++s++y++l++ +t+     e l+a++lf  ++ + k+
  Pahal.H00102.1 212 HTLLHCAKAVID-DRRSADELLKQIKVHASPTGDATQRLAYCFAQGLEARLAGTGSQVYRSLTADRTP---LLEFLKAYQLFMSTCCFRKV 298
                     89********97.8999*********************************************999999...9************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098512.082184300IPR005202Transcription factor GRAS
PfamPF035145.1E-15212298IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MVPRVFPGDA DEAASSYLNL SHIALLMEEE EEEDVAELSP DHPALLYAQQ PFCQILSGAP  60
FSPDQGPVFP GDRGSLNGCG HDKEYSTDMF TAAFFRGVEE ATKFLPADTA EKPLRSKESA  120
GGRGRRDRYS GGGGEQEAEA GRASKLATAE SAEAGAREMF DEMMLRGFDA CSKGMGGLTI  180
SMENVPATDN KKAGKRTRTR GKRRAAKVVD LHTLLHCAKA VIDDRRSADE LLKQIKVHAS  240
PTGDATQRLA YCFAQGLEAR LAGTGSQVYR SLTADRTPLL EFLKAYQLFM STCCFRKVEG  300
*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450070.11e-100hypothetical protein SORBIDRAFT_05g027786, partial
TrEMBLC5Y1S41e-100C5Y1S4_SORBI; Putative uncharacterized protein Sb05g027786 (Fragment)
STRINGSb05g027786.11e-100(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.12e-28GRAS family protein