PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 537aa    MW: 60209.4 Da    PI: 8.0887
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H00100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS290.74e-891595283373
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                      lL+ cA+av++g+   aq+lL++++++as++gd +qRla++f ++L+arla+++s+l + l+++      +++ l+a+kl+  ++ + +++ + 
  Pahal.H00100.1 159 ALLIPCAQAVAAGSVMTAQELLKQIKQNASSTGDDTQRLAQCFSKGLEARLAGTGSQLWQLLTAEGPL---VIKYLKAYKLYMAACCFNRVALFF 250
                     68***************************************************999999988887776...************************ PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                        +I  a++g++++Hi+D++  +G+QW+ Ll+ +a+R++gpp+++iT++++ ++    +e +e tg+rL k A+e+gvpf+++  ++ r+e++ 
  Pahal.H00100.1 251 NIMTIEHAMAGKSKLHIVDYGPHHGFQWVGLLRWMANRKGGPPEVKITAISRLQPRscPSEGIEDTGHRLGKCAREFGVPFKYHS-ITARWETIC 344
                     ****************************************************9999999**************************.699****** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++ ++++ +E+l+V   +    l+des  l+   +rd+vL+ +++++P+v++    ++++ ++sFl+rf eal yysalfd+l+a++pr+ + r+
  Pahal.H00100.1 345 TDFFKTDADEVLVVTDLFDFGILMDESIYLDRlsPRDTVLNNIRNMRPDVFIQGVVNSSY-GTSFLARFREALFYYSALFDMLDATIPRKCKLRS 438
                     ***************************9998877***********************999.679******************************* PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     ++E+ +lg ++ nv+aceg + ++  e++++W+ r ++aG++++pl+ +++k  k  + k + +g+ v e+  +l++gWk+r L++ S W
  Pahal.H00100.1 439 VLEQSMLGHSVLNVIACEGVDLVNHPEKYGQWQVRNQRAGLRQLPLKPNIVKVLKEKVMKDHHKGFFVGEDGRWLLQGWKGRILYAHSTW 528
                     ***********************************************************9999*************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.63131509IPR005202Transcription factor GRAS
PfamPF035141.4E-86159528IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MVLSYISRVL MEDGAEDKIL CGNSDHSALL QVQEPFAQIL FSPSISENSD NTTNKCNMER  60
AMNLLQGRNG NQCTLSSAFS KGEDAGGAFL KSIEEASRFL PRDNGIRKDQ LVKQECSNHR  120
ASKAMMMMEE LEDMFDKMML RGDKKGGSKM RTDVVDLCAL LIPCAQAVAA GSVMTAQELL  180
KQIKQNASST GDDTQRLAQC FSKGLEARLA GTGSQLWQLL TAEGPLVIKY LKAYKLYMAA  240
CCFNRVALFF NIMTIEHAMA GKSKLHIVDY GPHHGFQWVG LLRWMANRKG GPPEVKITAI  300
SRLQPRSCPS EGIEDTGHRL GKCAREFGVP FKYHSITARW ETICTDFFKT DADEVLVVTD  360
LFDFGILMDE SIYLDRLSPR DTVLNNIRNM RPDVFIQGVV NSSYGTSFLA RFREALFYYS  420
ALFDMLDATI PRKCKLRSVL EQSMLGHSVL NVIACEGVDL VNHPEKYGQW QVRNQRAGLR  480
QLPLKPNIVK VLKEKVMKDH HKGFFVGEDG RWLLQGWKGR ILYAHSTWVA EDAISE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-261615288374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450073.10.0hypothetical protein SORBIDRAFT_05g027795, partial
TrEMBLC5Y1S70.0C5Y1S7_SORBI; Putative uncharacterized protein Sb05g027795 (Fragment)
STRINGSb05g027795.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-108SCARECROW-like 14