PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H00097.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 603aa    MW: 68646.7 Da    PI: 6.6589
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H00097.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS306.94.7e-942245942373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      elL+ cA+av+++d ++a++lL++++++as++gd++qRla++f+++L+arl++++s+l++ l   + s    +e l+a++l+  ++ + ++  +
  Pahal.H00097.1 224 HELLTLCAQAVATNDRRRAHELLKQIKQHASETGDATQRLAQCFAKGLEARLVGTGSQLSQFLMEDHLS---IVEFLKAYNLYMAACCFNNVLLI 315
                     579999******************************************************999999988...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                         +I++a+ g++r+Hi+D+++ + ++W+ Ll+ La+R++gpp+++iT++g+p+     +e++ee+g rL+k A+++gvpf+f++ + k+++++
  Pahal.H00097.1 316 FSRMTIMQAMVGKRRLHIVDYGMRHWFHWAGLLHLLATREGGPPEVKITAIGHPHLRpcPAEQVEEIGCRLTKCAHKFGVPFNFHA-MRKNWDAV 409
                     *****************************************************998899***************************.8******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                      +e+L+++++E+l+Vn +++  +l+des   ++  ++d+vL+ +++++P+v++ +  ++++ ++s+l rf e l yy+a+fd+++a++pres+ r
  Pahal.H00097.1 410 CIEDLNTDTEEVLIVNDHFNFSSLMDESIFFDDpnPKDTVLHNIRKMRPHVFIQSILNCSY-GSSYLSRFREVLFYYTAIFDMFDATMPRESKSR 503
                     ****************************977766699************************.6789***************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     +++E+ l+gr + n++aceg + +er e++++W++r ++aG++++pl+ +++k  k  +r ++ + + + e++++l++gW++r L++ S W
  Pahal.H00097.1 504 VVLEQGLFGRYALNIIACEGVDLVERPERYRQWQARNQRAGLRKLPLEPNIVKVLKDKVRSCHHKDFFICEDDQWLLQGWMGRILFAQSTW 594
                     ***************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.976197575IPR005202Transcription factor GRAS
PfamPF035141.6E-91224594IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MAITPEEFFV EGLIEQSPPS PSIFLHVSMK PDGRSEGDHD APRDMILPYI SRVLMEDDID  60
DKISDHPRLL QVQQPFAQIL SSPSFGANTD NTANSSGENA LDSALSKGAG VVRAFLKGME  120
EANMLLPKDN GVNESSSKSG VKKRYNSDEH LEEEEEVRRT RKSVVMIKEP EDICAHEMLD  180
DMMLRSDETY IRGMEKLRIA MAKEVEKSSR KGVRKAVRNL LDIHELLTLC AQAVATNDRR  240
RAHELLKQIK QHASETGDAT QRLAQCFAKG LEARLVGTGS QLSQFLMEDH LSIVEFLKAY  300
NLYMAACCFN NVLLIFSRMT IMQAMVGKRR LHIVDYGMRH WFHWAGLLHL LATREGGPPE  360
VKITAIGHPH LRPCPAEQVE EIGCRLTKCA HKFGVPFNFH AMRKNWDAVC IEDLNTDTEE  420
VLIVNDHFNF SSLMDESIFF DDPNPKDTVL HNIRKMRPHV FIQSILNCSY GSSYLSRFRE  480
VLFYYTAIFD MFDATMPRES KSRVVLEQGL FGRYALNIIA CEGVDLVERP ERYRQWQARN  540
QRAGLRKLPL EPNIVKVLKD KVRSCHHKDF FICEDDQWLL QGWMGRILFA QSTWVAEGAS  600
LG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-312235944374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-118GRAS family protein