PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H00096.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 603aa    MW: 67513.3 Da    PI: 7.0554
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H00096.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.33.4e-1042205922374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lL++cAeav+++d + a  lL+r++ ++ p+gd ++Rla++f+e+L+arla+++s++y++l ++++s   ++ +++a++l+   + +l + hl
  Pahal.H00096.1 220 HTLLIRCAEAVATNDRRGAADLLERIKRHSPPTGDGTHRLAHCFAEGLEARLAGTGSKIYRSLMAKRAS---VVVAVKAYQLYMASCCFLPVKHL 311
                     679************************************************************999999...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                       N++I++av+g +++Hi+ ++++ GlQWp Ll+ La R++gpp++R+Tg+++p++g   ++ +eetg+rL++ A+++gvpf+f+  +ak+ e++
  Pahal.H00096.1 312 FSNKTIYKAVAGRKKLHIVHYGLGRGLQWPDLLRWLARREGGPPEVRLTGIDNPQPGfrPSQHIEETGRRLSNCARAFGVPFKFHG-IAKKSEAV 405
                     **************************************************************************************.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     ++e+L+++p+E+l Vn++l+ ++l+desv +e   +rd vL+++++++P v++++ ++ +h+s+ F++rf eal+ y+alfd++++ +pr+++ r
  Pahal.H00096.1 406 HVEDLDIDPHEVLLVNSILHFQTLMDESVVVERpnPRDMVLSTIRKMRPSVFIHTVNNGSHSSAFFMTRFREALQSYAALFDMMDSIAPRDNDRR 500
                     ****************************98887779*********************************************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       +Er +++  ++n++aceg +r+er +++++W++r ++aG++++pl+ ++++  k  ++k + + + + e++ +l++gWk+r L+++S W+
  Pahal.H00096.1 501 LLLERDMFAGCVTNIIACEGMDRVERPQSYKQWQARSQRAGLRQLPLDPEIVQMLKDKVKKEYHRSFLISEDQRWLLQGWKGRVLYALSTWT 592
                     ***************************************************************999*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.538193572IPR005202Transcription factor GRAS
PfamPF035141.2E-101220592IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MASTTPPSSS VFIDLPLAPR IDGGKVPAPD EDDNDLVLPY ISRMLMEEDM DDKFPDKYDA  60
ALLKAQQPFA EILSNAVQTC PCKISQPLHA ATVEANSSLL AAEGNCVDVV SMAFFKGMVE  120
ANKFLPIPKD SDCSRKKRLD RDDDEVEADE VAGRSSKQLA AAPQPESEEE AAAREMLDRL  180
MLHGYDPSLL ADMLPDHPPY HVMPPPPPRR GRHAVAVDLH TLLIRCAEAV ATNDRRGAAD  240
LLERIKRHSP PTGDGTHRLA HCFAEGLEAR LAGTGSKIYR SLMAKRASVV VAVKAYQLYM  300
ASCCFLPVKH LFSNKTIYKA VAGRKKLHIV HYGLGRGLQW PDLLRWLARR EGGPPEVRLT  360
GIDNPQPGFR PSQHIEETGR RLSNCARAFG VPFKFHGIAK KSEAVHVEDL DIDPHEVLLV  420
NSILHFQTLM DESVVVERPN PRDMVLSTIR KMRPSVFIHT VNNGSHSSAF FMTRFREALQ  480
SYAALFDMMD SIAPRDNDRR LLLERDMFAG CVTNIIACEG MDRVERPQSY KQWQARSQRA  540
GLRQLPLDPE IVQMLKDKVK KEYHRSFLIS EDQRWLLQGW KGRVLYALST WTADDDSDLA  600
QT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-402235918374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980083.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809331e-134SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3ZHQ90.0K3ZHQ9_SETIT; Uncharacterized protein
STRINGSi026111m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-125GRAS family protein