PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G02971.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 406aa    MW: 44714.8 Da    PI: 4.6895
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G02971.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.36.5e-4961341129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd el v+yLk+k+ gk+l++ ++i+e+d+yk+ PwdLp+  ++++++  wyfF++rd+ky++g r+nr+t  gyWkatgkd++v+
  Pahal.G02971.4   6 LPPGFRFHPTDVELTVYYLKRKLLGKHLRC-NAITEIDLYKFAPWDLPEkaSLESNDLVWYFFCPRDRKYSSGLRTNRSTGVGYWKATGKDRPVF 99 
                     79****************************.89***************52355556669************************************ PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       ++++vg+k+tLvf+ g+ p+g +tdWvm eyrle
  Pahal.G02971.4 100 Y-NSRTVGMKRTLVFHLGKPPRGDRTDWVMYEYRLE 134
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-603156IPR003441NAC domain
PROSITE profilePS5100555.1566156IPR003441NAC domain
PfamPF023656.3E-267133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MAKTSLPPGF RFHPTDVELT VYYLKRKLLG KHLRCNAITE IDLYKFAPWD LPEKASLESN  60
DLVWYFFCPR DRKYSSGLRT NRSTGVGYWK ATGKDRPVFY NSRTVGMKRT LVFHLGKPPR  120
GDRTDWVMYE YRLEDEELAA SGVKLDACVL CKIFQKSGPG PKIGAQYGAP FNEEDWNDAS  180
NVECSPFASS VAPCAPESSH GGLNSAGQHL AVSYDGKVSL APLSESNNEH TVNRVHPDRP  240
SPSIPVDSIH IQLLAEIIRC SSTNLLCTAA EDGSLPDSTA GYDNEDGESL DDIETIFCGV  300
DELASQPVVN NSNHCDSCEH LIHHMPEARG TEQYLELNDL FFSLAEGPDS SGMLLSNEIS  360
VEQPFDLEPR IERDSLDCIS NTVNTSTSTA DGPFPSVCAV DVHRT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-52215711169Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823524.10.0NAC domain-containing protein 82-like
RefseqXP_025823525.10.0NAC domain-containing protein 82-like
RefseqXP_025823526.10.0NAC domain-containing protein 82-like
RefseqXP_025823527.10.0NAC domain-containing protein 82-like
TrEMBLA0A2S3IBX80.0A0A2S3IBX8_9POAL; Uncharacterized protein
STRINGPavir.J14942.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.44e-81NAC domain containing protein 82