PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G02720.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 432aa    MW: 46717.9 Da    PI: 7.5208
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G02720.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32241295155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWt++LHerFv++v+qLGG++kAtPk il+lm+  gLt++h+kSHLQkYR+
  Pahal.G02720.3 241 KTRIRWTQDLHERFVDCVNQLGGADKATPKGILKLMNSGGLTIYHIKSHLQKYRI 295
                     68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.285238298IPR017930Myb domain
SuperFamilySSF466899.5E-18239295IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-29240296IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-23241296IPR006447Myb domain, plants
PfamPF002497.9E-9245294IPR001005SANT/Myb domain
PfamPF143791.0E-22326372IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MMNAKKIKLH DHHYGSPLCD PQMFPATAAA GLSFHPGLVS SLPQQHGGAG IWLHEEYTPT  60
PRTVPATQGS CVGADTAAFF AAEHLLGMAR FDFPLGTTTL PATMTVAKTP PFVRSPEAEQ  120
LYRPVDPLLL RDNSVRTYYV RPQQRDAPEA PPALKLPLQQ QQERGHELYG NGSSGRLLGG  180
EPKAHSFSAH VTAANTLLPA MEAPGLQSPT ENPLSRSCSI GAPVTHTGTV VAAPGHGAPS  240
KTRIRWTQDL HERFVDCVNQ LGGADKATPK GILKLMNSGG LTIYHIKSHL QKYRIAKYMP  300
ASTSEGKQEK RAAGNDAQNL DPSTGMQITE ALRVQLDVQR RLHEQLEIQR NLQLRIEAQG  360
KKLQKMFEEQ LKASRTVMEP PEEHPAQGVG ISAAAFAGVG EQEEEDGFDD VQLLSVAGSG  420
YSDARFPSKI S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-22241298158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-22241298158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-22241298158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-22241298158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0685131e-174BT068513.1 Zea mays full-length cDNA clone ZM_BFb0272J03 mRNA, complete cds.
GenBankEU9574861e-174EU957486.1 Zea mays clone 1594418 transfactor mRNA, complete cds.
GenBankKJ7268311e-174KJ726831.1 Zea mays clone pUT3371 G2-like transcription factor (GLK52) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822779.10.0probable transcription factor KAN2
RefseqXP_025822780.10.0probable transcription factor KAN2
TrEMBLA0A2S3IBB00.0A0A2S3IBB0_9POAL; Uncharacterized protein
STRINGPavir.Ga00160.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.17e-64G2-like family protein