PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G02710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ARF
Protein Properties Length: 949aa    MW: 104588 Da    PI: 6.0867
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G02710.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.31.4e-23143244199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k lt sd++++g +++p++ ae+       ++++++ ++l+++d++ + W++++iyr++++r++lt+GW+ Fv a++Lk+gD+v+F   ++++
  Pahal.G02710.1 143 FCKNLTASDTSTHGGFSVPRRAAEKLfpqldySMQPPN-QELIVRDLHDNLWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFI--RDEK 234
                     89*********************999*****9555555.49************************************************..4577 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                      +l+v+v+r+
  Pahal.G02710.1 235 SQLLVGVRRA 244
                     778*****97 PP

2Auxin_resp113.81.6e-37269351183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     aahaas++  F+++YnPr+s+s Fv+++ +++ka++++ svGmRf m+fete+ss+rr++Gt+vg+sd+dp+rWpnSkWr+L+
  Pahal.G02710.1 269 AAHAASSGGSFTIYYNPRTSPSPFVIPLTRYNKATYMQPSVGMRFAMMFETEESSKRRCTGTIVGISDYDPMRWPNSKWRNLQ 351
                     79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-44133272IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-40136257IPR015300DNA-binding pseudobarrel domain
CDDcd100173.49E-21142243No hitNo description
PfamPF023623.8E-21143244IPR003340B3 DNA binding domain
SMARTSM010199.6E-23143245IPR003340B3 DNA binding domain
PROSITE profilePS5086312.689143245IPR003340B3 DNA binding domain
PfamPF065073.9E-33269351IPR010525Auxin response factor
PROSITE profilePS5174524.028845929IPR000270PB1 domain
PfamPF023092.7E-9846932IPR033389AUX/IAA domain
SuperFamilySSF542773.01E-8861924No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 949 aa     Download sequence    Send to blast
MASSQEKATS GVLRNAAALL DEMQLMGEAQ GAKKVINSEL WHACAGPLVC LPQRGSLVYY  60
FPQGHSEQVA ATTKKVPNSR IPNYPSLPSQ LLCQVHNITL HADKETDEIY AQMTLQPVHS  120
ETDVFPIPTL GAYTKSKHPT EYFCKNLTAS DTSTHGGFSV PRRAAEKLFP QLDYSMQPPN  180
QELIVRDLHD NLWTFRHIYR GQPKRHLLTT GWSLFVGAKR LKAGDSVLFI RDEKSQLLVG  240
VRRATRQQPP LSSSVLSTDS MHIGVLAAAA HAASSGGSFT IYYNPRTSPS PFVIPLTRYN  300
KATYMQPSVG MRFAMMFETE ESSKRRCTGT IVGISDYDPM RWPNSKWRNL QVEWDEHGYG  360
ERSERVSLWD IETPENSLVF SSPLNSKRQC LPSYGVPGLQ IGSVNMSSIP RAQANPFGNL  420
QHMPGIGSEL ALMLLNQSGQ NLGSPLACQQ SSFSSIIQNV KHGYIPPSTF GSSTGSVKQE  480
NMLSNEAQQQ LNAPNIEKDD QVSCEVQPSI DSISVQELNV KARGPRNTDS YSSQSISDQN  540
SKGEPRTKTR RSKKGLSHKS ISDKSELSSV PSQIYDNKRH GSEPKLVDCE AEQVNCGDNE  600
DSSGALTRGG FAGEPQVQQV EQHELLSPPK LESSKSPDGG KSVSSFPNQG CSPQFFEGLD  660
WVIQPSYYQD SNGIHSVSGS ENILNQSTDI TSAINADTME AFQTSCLSEC FPNSVQEFIS  720
SPDLNSLTFM SHDMQHFEGQ HEVNNLPSTS NSYVQMSYSE ESGNQSASLS GLHMEAIHIN  780
SSCSEPVATG SFDTGMFSKL PDLRESQVLP LQEIHNSSMG TPSCSMDAAE YSIDRSAKPM  840
RPPVRTYTKV QKLGSVGRSI DVTRYRDYHE LRSAIACMFG LQGKLEHPGS SDWKLVYVDY  900
ENDVLLVGDD PWEEFINCVR CIRILSPSEV QQMSENGVHV LNDCIQIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A0.01737431390Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00153DAPTransfer from AT1G19850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824429.10.0auxin response factor 11
SwissprotQ01K260.0ARFK_ORYSI; Auxin response factor 11
SwissprotQ8S9830.0ARFK_ORYSJ; Auxin response factor 11
TrEMBLA0A2S3IBD30.0A0A2S3IBD3_9POAL; Auxin response factor
STRINGPavir.Ga00157.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86733241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein
Publications ? help Back to Top
  1. Shen C, et al.
    Functional analysis of the structural domain of ARF proteins in rice (Oryza sativa L.).
    J. Exp. Bot., 2010. 61(14): p. 3971-81
    [PMID:20693412]
  2. Indoliya Y, et al.
    Decoding regulatory landscape of somatic embryogenesis reveals differential regulatory networks between japonica and indica rice subspecies.
    Sci Rep, 2016. 6: p. 23050
    [PMID:26973288]