PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G02182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 377aa    MW: 40574.4 Da    PI: 8.8234
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G02182.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.5e-24113157145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRC +++ +++k+CErH+hrgr+rsrk++e+
  Pahal.G02182.1 113 DPEPGRCRRTDGKKWRCAKEAAPDSKYCERHMHRGRNRSRKPVEA 157
                     79****************************************996 PP

2QLQ61.42.4e-215893237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FTaaQ ++L++Q+l+yKyL+a++PvPp+Ll++i++
  Pahal.G02182.1 58 PFTAAQYEELEHQALIYKYLVAGVPVPPDLLLPIRR 93
                    9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-125793IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.2695893IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.3E-155892IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.773113157IPR014977WRC domain
PfamPF088798.5E-21114156IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MAMPFASLAP AADHRPSSLL PFCRAAPLSA VGEADAQQHH HHQHHAMSGG RWAARPAPFT  60
AAQYEELEHQ ALIYKYLVAG VPVPPDLLLP IRRGFVYHQP ALGYGPYFGK KVDPEPGRCR  120
RTDGKKWRCA KEAAPDSKYC ERHMHRGRNR SRKPVEAQLV ASPHAQQQPP AVTSGFQNQS  180
PYPAVLAGNG VRAGGGGGGV GTGTFGLGST AQLHMDSAAA YATAAGGGSK DLRHSAYGVR  240
SLSEYEHSQL MPAAMDTSMD NSWRLLPSQT PTFQATSYPL FGTLSGLDES TIASLPKTQR  300
EPLSFFGSDF VTVKQESQTL RPFFDEWPKA RDSWPELGDD NSLASFSATQ LSISIPMATS  360
DFSNTSSRSP SGIPSR*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5158450.0EF515845.1 Zea mays putative growth-regulating factor 6 (GRF6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824804.10.0growth-regulating factor 3-like isoform X1
SwissprotQ6AWY60.0GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLA0A2S3IA100.0A0A2S3IA10_9POAL; Uncharacterized protein
STRINGSi011853m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-46growth-regulating factor 5