PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G02173.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 275aa    MW: 30431.6 Da    PI: 9.2406
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G02173.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.19.8e-342074155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWtpeLH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Pahal.G02173.2 20 KPRLRWTPELHQRFVDAVDRLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 74
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-331775IPR009057Homeodomain-like
PROSITE profilePS5129413.2971777IPR017930Myb domain
TIGRFAMsTIGR015571.1E-242075IPR006447Myb domain, plants
SuperFamilySSF466895.55E-172075IPR009057Homeodomain-like
PfamPF002495.9E-102273IPR001005SANT/Myb domain
PfamPF143793.3E-21117163IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MLEGSYGGGG DGGAMSRDPK PRLRWTPELH QRFVDAVDRL GGPDKATPKS VLRLMGMKGL  60
TLYHLKSHLQ KYRLGRQGKK STGLELNGSG FAAQGLSFPT PTPVPGDPSE GKNTGEMPLA  120
DALKYQIQVQ RKLQEQLEVQ KKLQMRIEAQ GKYLKAILEK AKRNIPFDAN APSDHIDTTR  180
SQLMDFNLAL SGFMDNATRV CEESNEQLVK TISDDNHKDN LGFQLYQLGS QEAKEGKWTP  240
KTEDSLRLDL NIKGGYDLSS RGMQACELDL KINQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A9e-222076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-222076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-222076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-222076157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824515.10.0myb family transcription factor PHL11-like
SwissprotC0SVS48e-65PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A2S3IA010.0A0A2S3IA01_9POAL; Uncharacterized protein
STRINGPavir.Gb00791.1.p1e-173(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-56G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]