PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G02162.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LFY
Protein Properties Length: 387aa    MW: 41635.2 Da    PI: 9.3059
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G02162.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY530.66e-16213741385
         FLO_LFY   1 mdpea.fsas.lfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmksl 93 
                     mdp++ fsa+  f+wd       ppa++++ a +++ p     a +  + rele+l+ +yGvr +tva+i+elGft+stL++m+++eldd+m++l
  Pahal.G02162.1   1 MDPNDaFSAAhPFRWDLG-----PPAHAAP-APAPPLP----LAPQLGAPRELEDLVAGYGVRPSTVARISELGFTASTLLGMTERELDDMMAAL 85 
                     777654776558999953.....2322221.2122222....334445579******************************************** PP

         FLO_LFY  94 seifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkka 188
                     + +fr+d+l+Ger+G++aa+raer r+++      r      +  ++lda+sqe+ls+e++     aagsgg    ea+  +++ kk+ ++   a
  Pahal.G02162.1  86 AGLFRWDVLLGERFGLRAALRAERGRVMSLG---GRF-----HAGSTLDAASQEVLSDERD-----AAGSGGVADDEAGRRMVTGKKQAKKGAAA 167
                     ****************************965...455.....35678***********976.....77888888888887777766555555555 PP

         FLO_LFY 189 skkkqkrkkkkelkse..........ededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiaker 273
                     ++k +k ++kkel+            ed    +e+ e++ g+g +g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq+iak  
  Pahal.G02162.1 168 ARKGKKARRKKELRPLdvlgdendgdEDGGGGSESTESSAGGGGGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRVFLLQVQSIAKLS 262
                     44433333333322224666553321111112223333344777888************************************************ PP

         FLO_LFY 274 GekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiW 368
                     G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenvGawrqacy+plv+iaar+g+d+davf+ahprL+iW
  Pahal.G02162.1 263 GHKAPTKVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENVGAWRQACYAPLVEIAARHGFDVDAVFAAHPRLAIW 357
                     *********************************************************************************************** PP

         FLO_LFY 369 YvPtkLrqLChlerska 385
                     YvPt+LrqLCh++r ++
  Pahal.G02162.1 358 YVPTRLRQLCHQARGSQ 374
                     *************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-1851373IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MDPNDAFSAA HPFRWDLGPP AHAAPAPAPP LPLAPQLGAP RELEDLVAGY GVRPSTVARI  60
SELGFTASTL LGMTERELDD MMAALAGLFR WDVLLGERFG LRAALRAERG RVMSLGGRFH  120
AGSTLDAASQ EVLSDERDAA GSGGVADDEA GRRMVTGKKQ AKKGAAAARK GKKARRKKEL  180
RPLDVLGDEN DGDEDGGGGS ESTESSAGGG GGGGERQREH PFVVTEPGEV ARAKKNGLDY  240
LFHLYEQCRV FLLQVQSIAK LSGHKAPTKV TNQVFRYAKK CGASYINKPK MRHYVHCYAL  300
HCLDEEASNA LRRAYKARGE NVGAWRQACY APLVEIAARH GFDVDAVFAA HPRLAIWYVP  360
TRLRQLCHQA RGSQHAAAGL PPPPMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1002133732162PROTEIN LEAFY
2vy2_A1e-1002133732162PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1798820.0AY179882.1 Zea mays cultivar A632 floricaula/leafy-like 1 (fl1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826267.10.0probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLA0A2S3IA110.0A0A2S3IA11_9POAL; Uncharacterized protein
STRINGSi011756m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-98floral meristem identity control protein LEAFY (LFY)