PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G01962.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 300aa    MW: 32083.4 Da    PI: 9.5752
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G01962.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.21.2e-302174255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    pr+rWt +LH++Fv+a+e LGG++kAtPk il++m+ kgLt++hvkSHLQ+YR 
  Pahal.G01962.2 21 PRMRWTADLHRSFVRAIECLGGEDKATPKLILQFMGAKGLTISHVKSHLQMYRA 74
                    9****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-291775IPR009057Homeodomain-like
SuperFamilySSF466891.09E-151874IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-232174IPR006447Myb domain, plants
PfamPF002491.0E-72273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGGGGGVKNG AVRQYIRSKE PRMRWTADLH RSFVRAIECL GGEDKATPKL ILQFMGAKGL  60
TISHVKSHLQ MYRAARLGAA RRGMQASQLQ RRHSCAGDEQ GPKEFLCPPL KRSRMGTAAV  120
YESLQGSHGI SEARTAAAGS LHCVDDYMQA MAMRRRIKEE GLRWQRRDAA APAAAASNLQ  180
AVGCLVQESD RFKISRPEAN HLGLALNQQQ GSIEDGNGCS LFSSFSIAAK GEPPEQCSLS  240
LSLGLDPNSA RAMAASSPSE SSCILTASPA RRSSGDCSGH SDYFVFPGLS LELSLSMRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-172276357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-172276357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-172276357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-172276357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9619201e-85EU961920.1 Zea mays clone 239042 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025825829.10.0putative Myb family transcription factor At1g14600 isoform X2
TrEMBLA0A2S3IA570.0A0A2S3IA57_9POAL; Uncharacterized protein
STRINGPavir.Gb01051.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.12e-26G2-like family protein