PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G01034.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 394aa    MW: 42812.6 Da    PI: 5.7944
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G01034.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.47.9e-29205258255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      r+rWt+e+H+rF++av+qLGG e+A Pk+il++m+v+gLt+++vkSHLQkY+l
  Pahal.G01034.1 205 IRRRWTTEMHDRFIDAVNQLGGCENAKPKAILDIMNVEGLTRDQVKSHLQKYKL 258
                     69**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.617201261IPR017930Myb domain
SuperFamilySSF466891.7E-17202260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-27202259IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-23204259IPR006447Myb domain, plants
PfamPF002498.3E-9206257IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MSFHYESLYP HDMTLQSSPA STGAPCSASI IASSSSTFST VMTHGRFPNL LPSIVHPLNA  60
EILYSNPISH SGVSEQPLGG NYPGLPAETT HSADHLGGLL NNNGIDSVDK QPDSGSVRDP  120
NESDERDEWL TCLAGLDDFI TADMTSNYPQ MAESAHVSSP LNSETWQHEH IVHQLVSVPT  180
IPGHLYPTVS PPATTNVHSP QRTKIRRRWT TEMHDRFIDA VNQLGGCENA KPKAILDIMN  240
VEGLTRDQVK SHLQKYKLAQ VRHHSSEVGG TSVETTTSNE AIPSDVQIRI QKFALQVQME  300
LQKKLHEMVE RTRHDLLEIH RSILENHVMS LHELEERQNL NTDGRTVHLL PSPPAAAPSV  360
ALSRMPGEGS GTAASDEDGQ ASEAGLLGNN AGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-17204262260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-17204262260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-17204262260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-17204262260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-17204262260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-17204262260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-17204262260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-17204262260Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025825635.10.0protein PHOSPHATE STARVATION RESPONSE 2-like isoform X1
TrEMBLA0A2T7CXB80.0A0A2T7CXB8_9POAL; Uncharacterized protein
TrEMBLA0A2T8ID140.0A0A2T8ID14_9POAL; Uncharacterized protein
STRINGPavir.J07757.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16835911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.32e-25G2-like family protein